Recombinant Actinobacillus pleuropneumoniae serotype 3 Na (+)-translocating NADH-quinone reductase subunit E

Shipped with Ice Packs
In Stock

Description

Biological Function

The Na(+)-NQR complex catalyzes the oxidation of NADH and reduction of quinone, coupled with Na(+) translocation across the cytoplasmic membrane. Key functional roles include:

  • Energy Production: Generates a sodium motive force (SMF) instead of a proton gradient, critical for ATP synthesis and nutrient uptake in A. pleuropneumoniae .

  • Virulence: Essential for bacterial survival in host environments; mutants lacking functional NQR subunits show reduced persistence in porcine lung tissue .

  • Antimicrobial Target: Sensitivity to inhibitors like 2-n-nonyl-4-hydroxyquinoline N-oxide (HQNO) highlights its potential as a therapeutic target .

Expression and Purification

  • Host System: E. coli BL21 or DH5α strains .

  • Storage: Tris-based buffer with 50% glycerol; stable at -20°C/-80°C .

  • Purity: >85% (verified by SDS-PAGE) .

Research Use Cases

  • ELISA Development: Commercially available for serological detection of A. pleuropneumoniae infections .

  • Vaccine Design: Studies suggest NQR subunits are immunogenic and may serve as antigens in subunit vaccines .

Key Research Findings

StudyKey InsightCitation
NQR InhibitionHQNO blocks A. pleuropneumoniae growth, confirming NQR’s metabolic essentiality
Transcriptional Upregulationnqr operon expression increases during infection, enhancing bacterial survival
Phasevarion RegulationEpigenetic modulation via phase-variable methyltransferases affects NQR expression
Structural HomologyNqrE shares 76% identity with Haemophilus influenzae Nqr1, indicating conserved function

Clinical and Industrial Relevance

  • Diagnostics: Recombinant NqrE is used in ELISA kits to detect porcine pleuropneumonia .

  • Antibiotic Development: Targeting Na(+)-NQR could disrupt bacterial energy metabolism without affecting host cells .

  • Vaccine Development: Inclusion of NQR subunits in vaccine formulations may improve protection against A. pleuropneumoniae .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will accommodate your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nqrE; APJL_0155; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Target Names
nqrE
Target Protein Sequence
MEHYLSLFVKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGIAVIVVLGIAVPANQLVY THVLKDGALVEGVDLSFLNFITFIGVIAALVQILEMILDKFFPALYSALGIFLPLITVNC AIFGGVSFMVQREYNFTESVVYGLGAGTGWMLAIVALAGLTEKMKYSDVPAGLRGLGITF ITVGLMALGFMSFSGIQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two successive reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of Na(+)-translocating NADH-quinone reductase (Na+-NQR) in bacterial systems?

Na+-NQR is a respiratory enzyme complex that generates a sodium gradient by coupling electron transfer to ion translocation across bacterial membranes. This electrochemical gradient is essential for energy production in many pathogenic bacteria. In organisms like Vibrio cholerae, Na+-NQR oxidizes NADH and transfers electrons to ubiquinone while pumping sodium ions across the cytoplasmic membrane . The complex consists of six subunits (NqrA, B, C, D, E, and F) with multiple cofactors including FAD, FMN, riboflavin, and iron-sulfur centers that facilitate the electron transport chain . While most research has focused on Na+-NQR in V. cholerae, similar principles likely apply to the homologous complex in A. pleuropneumoniae.

Why focus on recombinant approaches for studying A. pleuropneumoniae proteins?

Recombinant protein technology offers significant advantages for studying bacterial proteins like those from A. pleuropneumoniae. This approach allows for:

  • Controlled expression of specific proteins without the need to handle pathogenic bacterial cultures

  • Production of sufficient quantities for structural and functional studies

  • Engineering of protein variants with specific tags for purification and detection

  • Development of subunit vaccines with precisely defined components

Recombinant proteins are produced by isolating the gene encoding the target protein, inserting it into an expression vector, and introducing this construct into a suitable host system (typically bacteria, yeast, or mammalian cells) that can express the protein in large quantities .

What expression systems are most effective for producing recombinant A. pleuropneumoniae proteins?

The choice of expression system depends on the specific requirements for protein folding, post-translational modifications, and intended application. For A. pleuropneumoniae proteins:

Bacterial expression systems:

  • Advantages: High yield, rapid growth, cost-effective

  • Common approach: E. coli BL21(DE3) with pET-based vectors

  • Considerations: May require optimization of codon usage and induction conditions

For membrane proteins like NqrE, consider:

  • E. coli C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

  • Addition of detergents during purification to maintain protein solubility

  • Use of fusion partners (MBP, SUMO) to enhance solubility

The cloning process typically involves PCR amplification of the target gene with appropriate restriction sites, followed by ligation into an expression vector containing a suitable promoter and affinity tag .

What purification strategies are recommended for recombinant NqrE?

Purification of membrane proteins like NqrE presents specific challenges:

  • Solubilization: Use mild detergents like n-dodecyl β-D-maltoside (DDM) or digitonin to extract membrane proteins

  • Affinity chromatography: Utilize His-tags or other fusion tags

  • Size exclusion chromatography: For final polishing and removal of aggregates

Example purification protocol:

  • Express protein in selected host system with appropriate affinity tag

  • Harvest cells and disrupt by sonication or French press

  • Solubilize membrane fraction with detergent

  • Perform immobilized metal affinity chromatography (IMAC)

  • Consider ion exchange chromatography as an intermediate step

  • Finish with size exclusion chromatography in the presence of stabilizing detergent

Protein purity should be assessed by SDS-PAGE and Western blotting using specific antibodies or tag detection reagents .

How can functional activity of recombinant NqrE be evaluated?

Assessing the functional activity of recombinant NqrE is challenging since it normally functions as part of a multi-subunit complex. Approaches include:

  • Reconstitution studies: Combining recombinant NqrE with other Na+-NQR subunits to restore complete complex activity

  • Membrane incorporation: Reconstituting purified NqrE into liposomes to study its contribution to ion transport

  • Binding assays: Assessing interaction with other subunits or specific cofactors

  • Structural characterization: Using techniques such as circular dichroism to confirm proper folding

Based on studies with other Na+-NQR systems, activity assays that monitor NADH oxidation coupled to quinone reduction and Na+ translocation would be informative when working with the complete complex .

How might NqrE be incorporated into recombinant subunit vaccines against A. pleuropneumoniae?

Na+-NQR subunit E could potentially be developed as a component of subunit vaccines against A. pleuropneumoniae, though current successful vaccines focus on Apx toxins. Key considerations include:

  • Antigen selection: Identifying immunogenic epitopes within NqrE that elicit protective responses

  • Carrier proteins: Conjugating NqrE epitopes to carrier proteins to enhance immunogenicity

  • Adjuvant selection: Optimizing adjuvant formulations to maximize immune response

  • Delivery systems: Exploring different delivery vehicles including liposomes or virus-like particles

Multicomponent recombinant subunit vaccines incorporating multiple antigens typically provide broader protection than single-antigen formulations. For example, vaccines containing recombinant Apx toxins (rApxI, rApxII, rApxIII) and outer membrane proteins have demonstrated effective cross-protection against both homologous and heterologous A. pleuropneumoniae challenge .

What methods can be used to evaluate immune responses to recombinant A. pleuropneumoniae proteins?

Several immunological techniques can assess immune responses to recombinant proteins:

ELISA (Enzyme-Linked Immunosorbent Assay):

  • Direct binding of antibodies to plate-immobilized recombinant antigens

  • Quantification of specific antibody titers in serum samples

  • Ability to determine isotype distribution (IgG, IgM, IgA)

Western blotting:

  • Confirmation of antibody specificity

  • Identification of linear epitopes recognized by immune sera

Functional assays:

  • Neutralization of toxin activity (for toxin-based antigens)

  • Opsonophagocytosis assays to evaluate antibody function

For A. pleuropneumoniae, specific ELISA methods have been developed to detect immune responses to each Apx toxin separately, which is crucial for evaluating vaccine efficacy during subunit vaccine development . Similar approaches could be developed for NqrE-based immunoassays.

How can cross-reactivity issues be addressed when developing immunoassays for A. pleuropneumoniae NqrE?

Cross-reactivity between related bacterial antigens can complicate immunoassay interpretation. Strategies to address this include:

  • Epitope mapping: Identifying unique regions within NqrE that do not share homology with related proteins

  • Recombinant fragments: Using specific domains or peptides rather than full-length proteins

  • Competitive assays: Including blocking steps with related antigens to improve specificity

  • Absorption steps: Pre-incubating sera with heterologous antigens to remove cross-reactive antibodies

When developing ELISA methods for A. pleuropneumoniae Apx toxins, researchers identified specific antigen regions among the toxins and cloned these regions to solve cross-reactivity problems . Similar approaches could be applied to NqrE, particularly if cross-reactivity with Na+-NQR subunits from other bacterial species is observed.

What structural and functional relationships exist between NqrE and the Na+ translocation mechanism?

The structural basis for Na+ translocation in Na+-NQR involves coordinated conformational changes across multiple subunits. Based on studies in V. cholerae:

  • The redox state of the intramembranous [2Fe-2S] cluster orchestrates movements of subunit NqrC

  • NqrC acts as an electron transfer switch, with its movement controlling Na+ release

  • The Na+ binding site is localized in subunit NqrB

While these specific details come from V. cholerae studies, they provide a framework for investigating similar mechanisms in A. pleuropneumoniae NqrE. Research questions might include:

  • Does A. pleuropneumoniae NqrE interact directly with the Na+ binding site?

  • How do conformational changes in NqrE coordinate with other subunits during the catalytic cycle?

  • Are there serotype-specific variations in NqrE structure that affect function?

How does the mechanism of A. pleuropneumoniae Na+-NQR compare to other respiratory enzymes?

Na+-NQR represents an evolutionarily distinct solution to respiratory energy conservation compared to the more widely studied Complex I (NADH:ubiquinone oxidoreductase):

FeatureNa+-NQRComplex I
Subunits6 (NqrA-F)~45 in eukaryotes, 14 in bacteria
CofactorsFAD, FMN, riboflavin, Fe-S centersFMN, multiple Fe-S clusters
Ion specificityNa+H+
Evolutionary originOnly in certain bacteriaWidely distributed across domains
Drug targetsPotential specific antibacterial targetsLess specific targeting

Understanding these differences is crucial for developing targeted antimicrobials, as Na+-NQR occurs only in bacteria and is prevalent in pathogens like V. cholerae and potentially drug-resistant strains of Pseudomonas and Klebsiella . The uniqueness of Na+-NQR makes it a promising target for new antibiotics.

What experimental approaches can determine the contribution of NqrE to A. pleuropneumoniae virulence?

Investigating the role of NqrE in A. pleuropneumoniae virulence requires sophisticated experimental designs:

  • Gene knockout/knockdown studies:

    • Creating NqrE deletion mutants

    • Assessing changes in growth, survival, and virulence

  • Transmission experiments:

    • Quantifying the transmission of wild-type versus NqrE-mutant A. pleuropneumoniae

    • Using the experimental design described by Velthuis et al., which includes:
      a. Creating subclinically infected carrier pigs through contact exposure
      b. Observing transmission to susceptible contact pigs
      c. Analyzing results with a generalized linear model (GLM)

  • Transcriptomic and proteomic analyses:

    • Comparing expression profiles between wild-type and NqrE-mutant strains

    • Identifying compensatory mechanisms when NqrE function is compromised

  • Animal infection models:

    • Evaluating tissue colonization and disease progression

    • Assessing immune responses to infection

These approaches would help determine whether NqrE is essential for A. pleuropneumoniae pathogenicity or if it represents a potential target for therapeutic intervention.

What novel approaches might enhance the immunogenicity of recombinant A. pleuropneumoniae proteins?

Emerging technologies offer opportunities to improve vaccine development using recombinant A. pleuropneumoniae proteins:

  • Structure-based antigen design:

    • Using structural biology to identify and enhance protective epitopes

    • Designing stabilized conformations that better present key epitopes

  • Multivalent antigen presentation:

    • Creating fusion proteins that combine multiple protective antigens

    • Developing nanoparticle-based presentation systems

  • Adjuvant technology:

    • Testing novel adjuvant combinations specifically tailored for respiratory pathogens

    • Evaluating mucosal adjuvants for enhanced respiratory protection

  • Delivery systems:

    • Exploring aerosol delivery for mucosal immunity

    • Investigating controlled-release formulations for prolonged antigen exposure

Current successful vaccines against A. pleuropneumoniae use combinations of recombinant Apx toxins (rApxI, rApxII, rApxIII) and outer membrane proteins . Future approaches might incorporate additional antigens like NqrE if they prove to contribute to protective immunity.

How might genomic and proteomic analyses advance our understanding of Na+-NQR in A. pleuropneumoniae?

Advanced -omics approaches can provide comprehensive insights into Na+-NQR biology:

  • Comparative genomics:

    • Analyzing NqrE sequence variation across A. pleuropneumoniae serotypes

    • Identifying conserved regions as potential broad-spectrum targets

  • Structural proteomics:

    • Determining high-resolution structures of A. pleuropneumoniae Na+-NQR components

    • Mapping interaction interfaces between subunits

  • Functional proteomics:

    • Identifying interaction partners of NqrE within the bacterial cell

    • Characterizing post-translational modifications that affect function

  • Systems biology:

    • Integrating multiple data types to model Na+-NQR's role in A. pleuropneumoniae metabolism

    • Predicting effects of targeting Na+-NQR on bacterial physiology

These approaches could reveal how Na+-NQR contributes to A. pleuropneumoniae adaptation to different environments and help identify vulnerabilities that could be exploited for therapeutic intervention.

What are the challenges and opportunities in developing inhibitors targeting Na+-NQR in pathogenic bacteria?

The unique nature of Na+-NQR presents both challenges and opportunities for drug development:

Challenges:

  • Membrane protein targets are generally difficult to work with

  • Limited structural information specifically for A. pleuropneumoniae Na+-NQR

  • Need for selective inhibition without affecting mammalian systems

Opportunities:

  • Na+-NQR is absent in mammals, offering potential selectivity

  • The enzyme is critical for energy metabolism in several pathogens

  • Recent structural insights from V. cholerae provide templates for rational drug design

Approaches for inhibitor development might include:

  • High-throughput screening against recombinant Na+-NQR components

  • Structure-based design targeting critical residues identified in homologous systems

  • Fragment-based approaches to identify initial binding scaffolds

  • Phenotypic screening for compounds that selectively inhibit growth of Na+-NQR-dependent bacteria

The development of specific Na+-NQR inhibitors could lead to novel antibiotics against A. pleuropneumoniae and other pathogens that rely on this enzyme complex.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.