Recombinant Actinobacillus pleuropneumoniae serotype 3 Prolipoprotein diacylglyceryl transferase (lgt)

What is Prolipoprotein diacylglyceryl transferase (lgt) and what is its role in bacterial physiology?

Prolipoprotein diacylglyceryl transferase (lgt) is an integral membrane enzyme that catalyzes the first reaction in the three-step post-translational lipid modification pathway of bacterial lipoproteins . This enzyme transfers a diacylglyceryl moiety from phosphatidylglycerol to prolipoprotein substrates, initiating the lipoprotein biosynthetic pathway that is essential for bacterial survival . The lipoproteins produced through this pathway fulfill wide-ranging and vital biological functions including maintenance of cell envelope architecture, insertion and stabilization of outer membrane proteins, nutrient uptake, transport, adhesion, invasion, and virulence .

In Gram-negative bacteria such as Actinobacillus pleuropneumoniae and Escherichia coli, lgt is particularly crucial, as deletion of the lgt gene is typically lethal . The enzyme represents a critical component of bacterial physiology as it enables the proper localization and function of numerous lipoproteins that maintain cellular integrity and mediate interactions with the external environment.

What structural features characterize lgt enzymes across bacterial species?

The crystal structures of Escherichia coli lgt have been resolved at high resolution (1.9 Å and 1.6 Å) in complex with phosphatidylglycerol and the inhibitor palmitic acid, respectively . These structures reveal that lgt contains two binding sites that are critical for its function in diacylglyceryl transfer . The enzyme possesses several conserved residues that are essential for catalytic activity, including Arg143 and Arg239, which have been confirmed through complementation studies using lgt-knockout cells and various mutant lgt variants .

The structural data supports a mechanism whereby substrate and product (lipid-modified lipobox-containing peptide) enter and leave the enzyme laterally relative to the lipid bilayer . This lateral gate mechanism is consistent with the transmembrane nature of lgt and explains how it can access both membrane lipids and protein substrates efficiently.

How does lgt from Actinobacillus pleuropneumoniae compare to lgt from other bacterial species?

Lgt enzymes show considerable sequence conservation across bacterial species while maintaining their essential function. When comparing Actinobacillus pleuropneumoniae lgt with those from other species, significant sequence homology is observed. For instance, complementation studies have shown that the lgt gene from Escherichia coli can be functionally replaced by lgt from Pseudomonas aeruginosa PA14 or Acinetobacter baumannii ATCC 17978, which share 51.6% and 48.6% sequence identity with E. coli lgt, respectively .

The amino acid sequence of Actinobacillus pleuropneumoniae serotype 3 lgt includes critical functional domains necessary for its enzymatic activity: MNEQFIQFPQIDPIIFSIGPIALRWYGLMYLIGFGFAYWLGMRRAKNSNGVWTTEQVDQLIYTCFWGVILGGRIGDVFFYNFDRLLQDPMFLFRIWEGGMSFHGGLIGVIVAMIWVSFRQKRSFWNTADFIAPLIPFGLGMGRIGNFINDELWGRITDVPWAVLFPSGGYLPRHPSQLYEFFLEGVVLFFILNWFIKKPRPAGSVAGLFLIGYGVFRFLVEYVRDIDPNVNTVDDLI . This sequence contains the characteristic membrane-spanning regions and catalytic residues essential for diacylglyceryl transfer.

What are the recommended methods for expressing and purifying recombinant Actinobacillus pleuropneumoniae lgt?

Recombinant expression of Actinobacillus pleuropneumoniae lgt requires careful consideration of its integral membrane protein nature. Based on successful approaches with E. coli lgt, the recommended expression system typically utilizes E. coli host strains optimized for membrane protein expression, such as C41(DE3) or C43(DE3) . The lgt gene should be cloned into an expression vector with an inducible promoter (e.g., T7) and an appropriate affinity tag to facilitate purification.

For purification, a multi-step protocol is recommended:

• Membrane fraction isolation through differential centrifugation after cell lysis

• Solubilization of membrane proteins using mild detergents (e.g., n-dodecyl-β-D-maltoside or lauryl maltose neopentyl glycol)

• Affinity chromatography using the incorporated tag

• Size exclusion chromatography for final purification

The purified protein should be stored in a buffer containing 50% glycerol and a Tris-based solution optimized for protein stability, as indicated in commercial preparations . For extended storage, maintaining the protein at -20°C or -80°C is recommended, with working aliquots kept at 4°C for up to one week to avoid repeated freeze-thaw cycles that could compromise protein integrity .

How can researchers assess the enzymatic activity of recombinant lgt in vitro?

Assessment of lgt enzymatic activity can be performed using several complementary approaches:

• GFP-based in vitro assay: A fluorescence-based assay can be used to measure lgt activity by monitoring the transfer of the diacylglyceryl moiety from a fluorescently labeled phosphatidylglycerol to a synthetic lipobox-containing peptide substrate . This approach allows for real-time monitoring of the enzymatic reaction.

• Radiolabeled substrate assay: Using radiolabeled phosphatidylglycerol (e.g., [³H] or [¹⁴C]-labeled) and measuring the incorporation of radioactivity into the peptide substrate provides a quantitative measure of enzymatic activity.

• Mass spectrometry-based assay: The transfer of the diacylglyceryl moiety can be monitored by analyzing the mass shift of the peptide substrate before and after the reaction using LC-MS/MS.

• Complementation assays: The functional activity of recombinant lgt can be assessed by its ability to complement an lgt-knockout bacterial strain. This approach has been successfully used to evaluate the activity of lgt variants with specific mutations, such as those affecting the critical residues Arg143 and Arg239 .

What experimental models are suitable for studying lgt function in the context of bacterial pathogenesis?

Several experimental models can be employed to study lgt function in bacterial pathogenesis:

• Inducible deletion strains: Creating bacterial strains with lgt under the control of an inducible promoter allows for controlled depletion of the enzyme and observation of the resulting phenotypes. This approach has been used with E. coli CFT073 and MG1655 strains to demonstrate that even modest depletion of lgt (~25%) leads to loss of bacterial viability .

• Mouse infection models: Animal models provide valuable insights into the role of lgt in pathogenesis. Studies with E. coli bacteremic infection models have shown that partial depletion of lgt results in significant attenuation of bacterial virulence .

• Serum resistance assays: Since lgt depletion affects cell envelope integrity, serum resistance assays can be used to assess the impact on bacterial survival. E. coli expressing reduced levels of lgt (~90% of normal) showed increased sensitivity to complement-mediated killing .

• Antibiotic susceptibility testing: Lgt depletion increases bacterial sensitivity to antibiotics normally excluded by the impermeable Gram-negative outer membrane. A comparison of minimum inhibitory concentrations (MICs) before and after lgt depletion provides valuable information about the impact on cell envelope integrity, as shown in the table below:

Note: Values approximated based on typical fold changes reported for lgt depletion .

What is the mechanistic role of critical residues like Arg143 and Arg239 in lgt function?

Complementation studies with lgt-knockout cells expressing different mutant lgt variants have identified Arg143 and Arg239 as essential residues for diacylglyceryl transfer activity . These positively charged arginine residues likely play crucial roles in substrate binding and catalysis:

• Arg143: Based on structural data, this residue is positioned to interact with the phosphate group of phosphatidylglycerol, facilitating proper substrate positioning within the active site. Mutation of this residue abolishes enzymatic activity, indicating its essential role in catalysis .

• Arg239: This residue appears to be involved in stabilizing the transition state during the diacylglyceryl transfer reaction. Its positive charge may help to neutralize the developing negative charge during the nucleophilic attack by the thiol group of the cysteine residue in the lipobox of the prolipoprotein substrate .

The structural arrangement of these residues creates an environment that promotes the catalytic transfer of the diacylglyceryl moiety from phosphatidylglycerol to the cysteine residue of the prolipoprotein substrate. Their conservation across bacterial species underscores their fundamental importance to the catalytic mechanism of lgt enzymes.

How does inhibition of lgt affect bacterial cell envelope integrity and viability?

Inhibition of lgt has profound effects on bacterial cell envelope integrity and viability through several interconnected mechanisms:

• Accumulation of unmodified prolipoproteins: Lgt inhibition results in the accumulation of unmodified pro-Lpp (UPLP), a major substrate of lgt . This accumulation disrupts normal lipoprotein processing and localization.

• Cell envelope destabilization: Even partial depletion of lgt (~25%) is sufficient to cause loss of bacterial viability, with cells showing increased permeability to molecules that normally cannot penetrate an intact outer membrane, such as SYTOX green dye .

• Morphological changes: Lgt depletion results in increased cell size and inner membrane contraction due to osmotic stress, as previously reported in multiple studies .

• Antibiotic hypersensitivity: Partial inhibition of lgt leads to increased sensitivity to antibiotics that are normally excluded by the impermeable Gram-negative outer membrane, despite normal growth in vitro .

• Attenuation of virulence: Depletion of lgt results in significant attenuation in mouse infection models, indicating its importance for bacterial pathogenesis .

Interestingly, unlike inhibition of other lipoprotein processing enzymes (LspA and LolCDE), the lethality caused by lgt inhibition cannot be rescued by deletion of the major lipoprotein gene lpp . This suggests that lgt inhibition affects multiple essential lipoproteins beyond Lpp, making it a particularly attractive antibiotic target.

What implications does the structural characterization of lgt have for antimicrobial drug development?

The detailed structural characterization of lgt, particularly the E. coli crystal structures at 1.9 Å and 1.6 Å resolution in complex with phosphatidylglycerol and the inhibitor palmitic acid , provides valuable insights for antimicrobial drug development:

• Rational inhibitor design: The identified binding sites and catalytic residues serve as targets for structure-based drug design. Compounds can be designed to specifically interact with critical residues like Arg143 and Arg239 to inhibit enzyme function.

• Resistance mitigation strategy: Since lgt inhibition cannot be rescued by lpp deletion (a primary mechanism of resistance to inhibitors of LspA and LolCDE) , lgt inhibitors may be less prone to this specific resistance mechanism, potentially extending their therapeutic utility.

• Synergistic approaches: Partial inhibition of lgt increases sensitivity to antibiotics normally excluded by the Gram-negative outer membrane . This suggests potential synergistic combinations of lgt inhibitors with existing antibiotics to enhance efficacy against resistant bacteria.

• Broad-spectrum potential: The conservation of lgt across bacterial species, combined with the ability of lgt from different species to functionally complement each other despite moderate sequence identity (48.6-51.6%) , suggests that lgt inhibitors could potentially have broad-spectrum activity against multiple bacterial pathogens.

The ability of lgt inhibitors to disrupt bacterial viability with even partial enzyme inhibition (~25%) suggests that they could be effective even at lower concentrations, potentially reducing side effects while maintaining antimicrobial efficacy.

How do lateral gene transfer dynamics affect the evolution of lgt in bacterial populations?

The evolution of lgt in bacterial populations is influenced by lateral gene transfer (LGT) dynamics, which shape bacterial genomic diversity over evolutionary timescales. Studies on LGT in bacterial genera like Streptomyces provide insights that may be applicable to understanding lgt evolution in Actinobacillus pleuropneumoniae:

• Rarity of successful gene transfers: Despite the common perception that lateral gene transfer is rampant in bacteria, successful acquisition and retention of genes through LGT are surprisingly rare over evolutionary timescales. In Streptomyces, only about 10 genes per million years were acquired and subsequently maintained through LGT .

• Effect of phylogenetic distance: Gene transfers between closely related lineages are orders of magnitude more frequent than transfers from distantly related bacteria . This suggests that lgt genes from closely related Actinobacillus strains are more likely to be successfully transferred than those from phylogenetically distant bacteria.

• Correlation with evolutionary distance: The estimated transfer rate decreases steadily with branch length according to a two-thirds power law, likely due to acquisition and subsequent loss of genes with neutral or deleterious fitness effects . This suggests that most acquired genes are not retained over evolutionary time unless they confer selective advantages.

• Essential gene conservation: As lgt is essential for bacterial viability in most Gram-negative bacteria , strong selective pressure likely maintains its functional conservation despite potential LGT events. This may lead to limited sequence variation in functionally critical regions of the enzyme across bacterial species.

Understanding these LGT dynamics provides context for interpreting sequence diversity in lgt genes across bacterial populations and may inform strategies for developing antimicrobials targeting lgt with reduced potential for resistance development through gene acquisition from other bacteria.

What methods are available for detecting Actinobacillus pleuropneumoniae in clinical samples?

Detection of Actinobacillus pleuropneumoniae in clinical samples can be achieved through several complementary approaches:

• Multiplex RT-PCR assays: Similar to the multiplex Lightmix® RT-PCR assay used for detecting fastidious respiratory pathogens, molecular detection methods can be developed specifically for A. pleuropneumoniae . These assays offer high sensitivity and specificity, with limits of detection between 5 and 10 DNA copies for different organisms .

• ELISA-based detection: Recombinant A. pleuropneumoniae lgt can be used as an antigen in ELISA assays to detect specific antibodies in clinical samples, indicating current or previous infection . Commercial ELISA kits utilizing recombinant A. pleuropneumoniae proteins are available for research purposes .

• Culture methods with serum supplementation: Traditional culture methods for A. pleuropneumoniae may be enhanced by serum supplementation, as indicated by studies on antibiotic activity testing . This approach can improve the recovery of the pathogen from clinical samples.

• Immunohistochemistry: Antibodies against A. pleuropneumoniae antigens, including lgt, can be used for direct detection of the pathogen in tissue samples through immunohistochemical staining.

These detection methods vary in their sensitivity, specificity, and time-to-result, with molecular methods generally offering the fastest and most sensitive detection but requiring specialized equipment and expertise.

How can recombinant lgt be utilized in vaccine development against Actinobacillus pleuropneumoniae?

Recombinant lgt from Actinobacillus pleuropneumoniae has potential applications in vaccine development through several strategies:

• Subunit vaccines: Purified recombinant lgt, or immunogenic epitopes derived from it, can be used as antigens in subunit vaccines. Since lgt is an essential enzyme for bacterial viability , antibodies targeting it might effectively neutralize the pathogen.

• Polyvalent bacterial lysates (PBL): Standardized bacterial lysates containing multiple antigens, including lgt, can be developed as oral immunostimulating vaccines. Studies have shown that PBL can be effective against upper respiratory tract bacterial colonization by potential pathogens .

• Autovaccines: Individually prepared vaccines based on patient-specific bacterial isolates can include lgt as a target antigen. Comparative studies between PBL and autovaccines have shown differential effectiveness against various bacterial species .

• Adjuvant design: Understanding the immunostimulatory properties of bacterial lipoproteins, whose biogenesis depends on lgt, can inform the design of more effective adjuvants to enhance vaccine efficacy.

When comparing the effectiveness of different vaccine approaches, studies have shown that autovaccines may be more effective than PBL for reducing bacterial counts of certain species like Streptococcus pneumoniae and β-hemolytic streptococci, while PBL was more effective against Haemophilus influenzae colonization . Similar comparative studies would be valuable for determining the optimal vaccination strategy against A. pleuropneumoniae.