Recombinant Actinobacillus pleuropneumoniae serotype 3 Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Functional Properties

HtpX is implicated in bacterial stress adaptation and virulence:

  • Proteolytic Activity: Degrades host proteins like porcine IgA and hemoglobin, facilitating immune evasion .

  • Metal Dependency: Inhibited by EDTA (10 mM) but reactivated by calcium, suggesting metalloprotease characteristics .

  • Thermal Stability: Retains activity after heating to 90°C for 5 minutes .

  • Stress Response: Likely assists in protein quality control under stress (e.g., heat, oxidative conditions) .

Optimal Conditions:

  • pH Range: 4–8 (optimal pH 6–7)

  • Substrates: Porcine IgA, hemoglobin, gelatin

3.1. Immunological Studies

  • Antigenicity: Recognized by convalescent sera from infected pigs, suggesting diagnostic potential .

  • Vaccine Development: While not yet tested in vaccines, related APP proteases are explored for cross-protective immunity .

3.2. Mechanistic Insights

  • Cell Division Regulation: Indirectly linked to potassium stress tolerance via the CpxAR system, which upregulates cell division genes (e.g., ftsEX) .

  • Virulence Modulation: Degrades host defense molecules (e.g., immunoglobulins), enhancing bacterial survival .

Comparative Analysis with Other Serotypes

HtpX homologs exist across APP serotypes but differ in structure and application:

SerotypeUniProt IDExpressionKey Features
3B0BPX8Full-length (1-289aa)Used in ELISA, structural studies
7B3H1S0Partial proteinLimited functional data; lower stability

Industrial and Diagnostic Use

  • ELISA Kits: Commercialized for APP detection (e.g., CSB-CF533220AXH) .

  • Protein Interaction Studies: Utilized to investigate HtpX’s role in metal ion homeostasis and stress pathways .

Challenges and Future Directions

  • Functional Redundancy: Overlap with other APP proteases (e.g., Apx toxins) complicates targeted studies .

  • Therapeutic Targeting: Potential for inhibitor development against HtpX to mitigate APP infections .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. If you have specific format requirements, please specify them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; APJL_1057; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Target Names
htpX
Target Protein Sequence
MAKRIVLFLLTNLAITFVLGIVLNIIFQVTGIQGGSTGGILVMSLVFGFAGSLISLFMSK SMALRSVGAEVIQQPRNHAEQWLFDTVQRQSQQANIPMPDIAIYHSADVNAFATGATKNN SLVAVSTGLLDNMTEDEAEAVVAHEIAHIANGDMVTMTLLQGVLNTFVIFLSRIISTAAS SGKDENGNATQNTLVFWIVDIALQMIFGVIATMIAMWFSRYREYRADAGSAQLVGKEKMI AALQRLQHVHEPQEMQGSLAAFMINGARSKELFMSHPPLEKRIEALRNL
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Methodological Questions

  • What are the optimal conditions for assaying HtpX protease activity in vitro?

    Establishing reliable in vitro assays for HtpX activity presents challenges due to its membrane-embedded nature, but several approaches can be employed:

    1. Protein preparation:

      • Recombinant expression systems: E. coli-based systems with membrane protein optimization

      • Purification approach: Detergent solubilization followed by affinity chromatography

      • Reconstitution: Into proteoliposomes or nanodiscs to restore native-like membrane environment

    2. Assay conditions:

      • Buffer composition: 50 mM Tris-HCl or HEPES (pH 7.5-8.0), 100-150 mM NaCl, 5% glycerol

      • Metal cofactor: 1-5 mM ZnCl₂ (as HtpX is a zinc metalloprotease)

      • Reducing agent: 1-5 mM DTT or 2-mercaptoethanol

      • Detergent concentration: Above critical micelle concentration but optimized to maintain activity

      • Temperature: 30-37°C (physiologically relevant)

    3. Substrate options:

      • Fluorogenic peptide substrates: Custom peptides based on predicted cleavage sites with FRET pairs

      • Model membrane proteins: Purified membrane proteins known to be misfolded

      • Synthetic transmembrane segments: Designed peptides mimicking HtpX substrates

    4. Detection methods:

      • Fluorescence-based: Monitoring cleavage of FRET-paired substrates

      • SDS-PAGE analysis: Visualizing degradation of protein substrates

      • Mass spectrometry: Identifying cleavage products and sites

    Control reactions should include:

    • Heat-inactivated enzyme

    • Catalytically inactive mutant (H→A mutation in HEXXH motif)

    • Reactions with metalloprotease inhibitors (EDTA, 1,10-phenanthroline)

    The recombinant HtpX from A. pleuropneumoniae serotype 3 (strain JL03) available commercially is typically supplied in a storage buffer containing Tris-based buffer with 50% glycerol , which needs to be considered when designing assays.

  • How can knockout or knockdown approaches be designed to study HtpX function in A. pleuropneumoniae?

    Several genetic manipulation strategies can be employed to investigate HtpX function in A. pleuropneumoniae:

    1. Complete gene knockout:

      • Homologous recombination: Replace htpX with an antibiotic resistance cassette

      • Suicide vector approach: Use vectors that cannot replicate in A. pleuropneumoniae

      • Selection markers: Appropriate antibiotic resistance genes

      • Verification: PCR, Southern blotting, and RT-PCR to confirm gene deletion

    2. Conditional knockdown:

      • Inducible promoter replacement: Replace native promoter with tetracycline-inducible system

      • Riboswitch control: Engineer an inducible riboswitch to control translation

      • Temperature-sensitive alleles: Create mutations rendering HtpX functional only at permissive temperatures

      • CRISPRi: dCas9-based repression of htpX expression

    3. Dominant-negative approach:

      • Express catalytically inactive HtpX (H→A mutation in HEXXH motif)

      • Overexpress specific HtpX domains that interfere with native protein function

      • Design degron-tagged HtpX for controlled protein degradation

    4. Complementation strategies:

      • Trans-complementation: Reintroduce htpX on plasmid vectors

      • Chromosomal restoration: Return htpX to its native locus

      • Heterologous complementation: Test functional conservation with htpX from other species

    Technical considerations specific to A. pleuropneumoniae:

    • Transformation efficiency is typically low; electroporation often works better than chemical transformation

    • Natural competence can be induced in some strains under specific conditions

    • Selective media must be carefully optimized for transformation experiments

    • Genomic integration efficiency can be enhanced by using DNA from the same serotype

    Phenotypic analysis of htpX mutants should include growth curves under normal and stress conditions, membrane integrity assessments, proteomic profiling, and virulence assessment in cell culture and animal models .

  • What expression systems are most suitable for producing recombinant HtpX for structural studies?

    Producing sufficient quantities of properly folded HtpX for structural studies requires careful selection of expression systems:

    1. E. coli-based systems:

      • Specialized strains designed for membrane protein expression

      • Fusion partners: MBP, SUMO, or Mistic to enhance solubility and membrane targeting

      • Expression vectors with tight control for high-level expression

      • Growth conditions: Lower temperatures (16-25°C) and reduced inducer concentrations

      • Media optimization: Supplementation with zinc and addition of molecular chaperones

    2. Yeast expression systems:

      • Pichia pastoris: Capable of high-density growth and controlled induction

      • Saccharomyces cerevisiae: Well-established for membrane protein expression

      • Advantages: More native-like membrane environment and post-translational processing

      • Expression control: Methanol-inducible or constitutive promoters

      • Scale-up potential: Adaptable to fermentation for larger yields

    3. Insect cell systems:

      • Baculovirus expression vector system (BEVS)

      • Cell lines: Sf9 or High Five cells

      • Advantages: Near-native membrane composition and protein processing

      • Challenges: More complex setup and higher cost

    4. Cell-free expression systems:

      • E. coli or wheat germ extract-based systems

      • Direct incorporation into nanodiscs or liposomes during synthesis

      • Rapid production and avoidance of toxicity issues

      • Suitable for initial screening and optimization

    Expression optimization parameters:

    ParameterStrategyEvaluation Method
    Affinity tag placementTest N-terminal, C-terminal, and internal tagsWestern blot, activity assay
    Detergent screeningTest 8-12 different detergentsSize-exclusion chromatography
    Induction conditionsVary temperature, inducer concentration, timeSDS-PAGE, Western blot
    Purification protocolOptimize buffer components and purification stepsProtein yield, purity, stability
    Stabilizing additivesScreen lipids, cholesterol, specific substratesThermal stability assays

    For structural studies, protein quality is paramount. Techniques like fluorescence-detection size exclusion chromatography (FSEC) can help identify the most promising constructs and conditions before scaling up .

  • How can the specificity of HtpX for various substrates be determined experimentally?

    Determining HtpX substrate specificity requires a multi-faceted approach:

    1. Global proteomic identification:

      • Stable Isotope Labeling with Amino acids in Cell culture (SILAC): Compare protein abundance in wild-type vs. htpX mutant strains

      • Pulse-chase proteomics: Monitor protein turnover rates dependent on HtpX

      • Quantitative membrane proteomics: Focus specifically on membrane protein changes

      • Degradomics approaches: Identify neo-N-termini generated by HtpX cleavage

    2. Candidate substrate validation:

      • In vitro cleavage assays: Purify potential substrates and test direct cleavage by HtpX

      • Co-expression studies: Express HtpX with candidate substrates and monitor degradation

      • Site-directed mutagenesis: Modify predicted cleavage sites and assess protection from degradation

      • Protein-protein interaction: Co-immunoprecipitation or crosslinking to capture enzyme-substrate complexes

    3. Cleavage site determination:

      • Mass spectrometry: N-terminal sequencing of cleavage products

      • Proteomic Identification of Cleavage Sites (PICS): Library-based approach to determine cleavage preferences

      • Peptide library screening: Synthetic peptide arrays to identify sequence preferences

      • Deep sequencing-based methods to identify protease substrates

    4. Structural determinants of specificity:

      • Bioinformatic analysis: Predict common structural features in substrates

      • Synthetic substrate variations: Systematically modify substrate properties (hydrophobicity, charge)

      • Domain swapping: Create chimeric proteins to identify recognition domains

      • Cross-species comparison: Test substrate conservation across bacterial species

    5. In vivo confirmation:

      • Reporter fusions: Create fluorescent or enzymatic reporters of substrate cleavage

      • Conditional degradation systems: Engineer substrate degradation dependent on HtpX

      • Time-lapse microscopy: Visualize substrate degradation in living cells

    Data analysis should focus on identifying patterns in amino acid preferences near cleavage sites, structural features, subcellular localization of substrates, and conditions that enhance or inhibit cleavage. These approaches would be particularly valuable given the identified genomic and proteomic characteristics of A. pleuropneumoniae serotype 3 strain JL03 .

  • What techniques can be used to visualize and track HtpX localization in bacterial cells?

    Visualizing membrane proteins like HtpX in bacterial cells presents technical challenges but several approaches can provide valuable insights:

    1. Fluorescent protein fusions:

      • GFP/mCherry/mScarlet fusions at C- or N-terminus (if compatible with function)

      • Superfolder GFP variants optimized for membrane protein tagging

      • Split-GFP approaches to minimize disruption of membrane integration

      • Photoactivatable or photoconvertible fluorescent proteins for pulse-chase studies

      • Considerations: Validate that fusion does not disrupt localization or function

    2. Immunofluorescence microscopy:

      • Generate specific antibodies against HtpX or epitope tags

      • Cell fixation and permeabilization optimized for membrane proteins

      • Super-resolution techniques to overcome diffraction limit

      • Multi-color imaging to co-localize with other cellular components

      • Challenges: Maintaining membrane structure during fixation procedures

    3. Electron microscopy approaches:

      • Immunogold labeling for transmission electron microscopy

      • Cryo-electron tomography for near-native state visualization

      • Correlative light and electron microscopy (CLEM)

      • High spatial resolution but complex sample preparation

    4. Non-fusion approaches:

      • Click chemistry with unnatural amino acids incorporated into HtpX

      • HaloTag or SNAP-tag technologies for flexible labeling options

      • Proximity labeling to map the HtpX neighborhood

      • Minimizes disruption to protein structure and function

    5. Dynamic tracking:

      • Fluorescence Recovery After Photobleaching (FRAP) to measure protein mobility

      • Single-particle tracking with quantum dots or other bright labels

      • Microfluidic approaches for controlled environmental changes during imaging

      • Time-lapse studies to monitor redistribution under stress conditions

    Visualization challenges specific to A. pleuropneumoniae include small cell size requiring high-resolution imaging, limited genetic tools compared to model organisms, and need for physiologically relevant growth conditions. These approaches can reveal HtpX distribution patterns, potentially identifying specific membrane domains or dynamic responses to environmental conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.