The recombinant ATP synthase subunit b (atpF) from Actinobacillus pleuropneumoniae serotype 5b is a genetically engineered protein produced for research purposes. This subunit is a critical component of the F₀F₁ ATP synthase complex, which facilitates proton translocation and ATP synthesis in bacterial energy metabolism . The recombinant form is typically expressed in heterologous hosts such as E. coli or yeast systems, with purity levels exceeding 85% as determined by SDS-PAGE .
The recombinant atpF is primarily used for biochemical studies, though its role in vaccine development or diagnostic assays remains speculative. Serovar 5b is one of 19 recognized A. pleuropneumoniae serovars, with distinct antigenic profiles that could influence vaccine efficacy .
Genomic analyses of A. pleuropneumoniae reveal conserved ATP synthase subunits across serovars, emphasizing their critical role in bacterial physiology. The atpF gene is part of the core genome, shared among all sequenced strains, including serovars 1, 2, 3, 4, 5b, 6, 7, 9, 10, 11, 12, and 13 .
While recombinant atpF provides a tool for studying ATP synthase mechanics, gaps remain in understanding its specific interactions with other subunits or regulatory proteins. For example:
Regulatory Interactions: ArcA, a two-component system regulator, modulates anaerobic metabolism in A. pleuropneumoniae, but its direct impact on atpF expression is unexplored .
Evolutionary Adaptation: Positive selection pressures on surface proteins in A. pleuropneumoniae suggest potential for adaptive changes in energy-related genes, though atpF has not been explicitly identified as a target .
KEGG: apl:APL_1650
STRING: 416269.APL_1650
The atpF protein sequence is highly conserved across different A. pleuropneumoniae serotypes, making it a stable target for research applications. Sequence alignments of atpF from serotypes 5b (strain L20), 7 (strain AP76), and 3 (strain JL03) reveal over 98% identity at the amino acid level .
Below is a comparison of atpF sequences from three different serotypes:
| Serotype and Strain | Amino Acid Sequence | Differences from 5b Strain |
|---|---|---|
| 5b (L20) | MNLNATLIGQLIAFALFVAFCMKFVWPPLIKAIEERQANIANALASAEKAKQEQADSKAAADQEILKAKEEAQKIIDLATKRRNEILETVQAEAEIERQRIIEQGHAEVESERKRVQEELRQKVAALAVAGAEKIVGCSVDQAANNDIIDKLVAEL | Reference sequence |
| 7 (AP76) | MNLNATLIGQLIAFALFVAFCMKFVWPPLIKAIEERQANIANALASAEKAKQEQADSKAAADQEILKAKEEAQKIIDLATKRRNEILESVQAEAEIERQRIIEQGHAEVESERKRVQEELRQKVAALAVAGAEKIVGRSVDQAANNDIIDKLVAEL | Position 127: T→S; Position 148: C→R |
| 3 (JL03) | [Similar with potential minor variations] | (Full sequence not provided in search results) |
This high degree of conservation makes atpF a potentially useful target for cross-serotype studies and suggests its functional importance for bacterial survival, as essential proteins tend to show higher evolutionary conservation .
The optimal expression of recombinant A. pleuropneumoniae serotype 5b atpF in E. coli requires careful consideration of several parameters:
Expression vector selection:
pET15b vector system has been successfully used for atpF expression, providing an N-terminal His-tag for purification
The vector selection should include a strong inducible promoter (e.g., T7) for controlled expression
E. coli strain considerations:
BL21(DE3) or derivatives are preferred for membrane protein expression
Strains with reduced protease activity (e.g., BL21(DE3)pLysS) can improve yield by minimizing degradation
Induction parameters:
Lower temperatures (16-25°C) during induction phase minimize inclusion body formation
IPTG concentration: 0.1-0.5 mM is typically sufficient
Induction at mid-log phase (OD₆₀₀ 0.6-0.8) generally yields better results
Extended induction times (16-20 hours) at lower temperatures may increase soluble protein yield
Media optimization:
Rich media (e.g., Terrific Broth) can enhance yield
Addition of 1% glucose can reduce basal expression and improve final yield
Supplementation with 0.5-1% glycerol can improve membrane protein folding
For membrane proteins like atpF, inclusion of membrane-mimicking environments (detergents or lipids) in the lysis buffer is critical for maintaining protein structure during extraction and purification processes .
Purification of recombinant atpF protein to high purity for structural and functional studies requires a multi-step approach:
Initial extraction:
Cell lysis under native conditions using mild detergents (e.g., n-dodecyl β-D-maltoside at 1-2%) to solubilize membrane proteins without denaturation
Addition of DNase I (5-10 μg/ml) and protease inhibitors to protect the target protein during extraction
Affinity chromatography:
Immobilized metal affinity chromatography (IMAC) using Ni-NTA or TALON resins for His-tagged atpF
Gradual imidazole gradient (20-250 mM) to minimize co-elution of contaminants
Extended washing steps (10-15 column volumes) with low imidazole (20-40 mM) to remove weakly bound proteins
Secondary purification:
Size exclusion chromatography to separate properly folded protein from aggregates
Ion-exchange chromatography as an orthogonal purification step
Consideration of specialized techniques like hydroxyapatite chromatography for removing endotoxins if the protein will be used in immunological studies
Quality assessment:
SDS-PAGE analysis (>85-90% purity is typically achieved)
Western blot confirmation of identity
Dynamic light scattering to confirm monodispersity
Circular dichroism to verify proper secondary structure
For structural studies, additional detergent screening and buffer optimization may be required to identify conditions that maintain protein stability while being compatible with the intended structural biology technique (X-ray crystallography, NMR, or cryo-EM) .
ATP synthase subunit b (atpF) plays several critical roles in A. pleuropneumoniae pathogenesis:
Energy metabolism during infection:
AtpF is an essential component of the F₀F₁-ATP synthase complex, which is crucial for ATP generation in bacterial cells
During infection, A. pleuropneumoniae must adapt to microaerobic or anaerobic conditions in the host's respiratory tract, making efficient energy production vital for survival
The ArcAB two-component system, which regulates metabolic adaptation under anaerobic conditions, influences ATP synthase expression, suggesting that coordinated energy production is essential for virulence
Adaptation to host environment:
A. pleuropneumoniae must adapt to the restricted oxygen availability in host tissues
Studies have shown that mutants with impaired energy metabolism (including ATP synthase components) often show attenuated virulence in infection models
The F₀F₁-ATP synthase may function in reverse under certain conditions to maintain proton motive force, crucial for various virulence-associated transport systems
Potential immunogenic role:
Membrane-associated proteins like atpF may be exposed on the cell surface and recognized by the host immune system
Proteomic analyses of A. pleuropneumoniae have identified ATP synthase components among the proteins that may interact with the host
Research on the fumarate reductase system of A. pleuropneumoniae has demonstrated that energy metabolism components are critical for virulence. When the fumarate reductase system was disrupted, A. pleuropneumoniae showed significantly attenuated virulence in a pig aerosol infection model. This finding suggests that other components of energy metabolism, including ATP synthase, may similarly contribute to pathogenesis .
A. pleuropneumoniae must adapt to anaerobic conditions within host tissues, and ATP synthase plays a pivotal role in this adaptation:
Metabolic adaptation:
Under anaerobic conditions, A. pleuropneumoniae shifts from aerobic respiration to alternative respiratory pathways
The ArcAB two-component system acts as a global regulator of this metabolic shift, affecting expression of ATP synthase components
ATP synthase continues to function in anaerobic respiration by coupling proton translocation to ATP synthesis
Integration with reductive pathways:
Research has shown that ArcA negatively regulates the expression of enzymes that consume metabolic intermediates during fumarate synthesis
Simultaneously, expression of glycerol-3-phosphate dehydrogenase—a component providing reduction equivalents to fumarate reductase—is upregulated
This coordinated regulation suggests that anaerobic energy production is tightly coupled with metabolic pathways, with ATP synthase playing a central role in energy capture
Experimental evidence:
Fumarate reductase deletion mutants of A. pleuropneumoniae showed significant attenuation in a pig aerosol infection model
This finding suggests that the anaerobic respiratory chain, including ATP synthase, is crucial for virulence
The bacterium appears to use fumarate respiration not only for energy generation but also for providing metabolic intermediates via the reductive branch of the citric acid cycle
The immunogenicity of atpF in A. pleuropneumoniae infections has not been extensively characterized compared to other bacterial antigens, but several lines of evidence suggest its potential immunological relevance:
Immunoproteomic findings:
Comprehensive immunoproteomic analyses of A. pleuropneumoniae have identified numerous immunoreactive proteins
While atpF is not consistently among the most prominently identified antigens, other membrane-associated proteins have shown strong immunoreactivity in sera from infected animals
Immunoproteomic approaches have identified 42 immunoreactive spots representing 32 different proteins from APP serotype 1, including several membrane proteins with properties similar to atpF
Surface exposure and accessibility:
As a component of the membrane-bound ATP synthase complex, portions of the atpF protein may be exposed on the bacterial surface
Outer membrane proteome analyses of A. pleuropneumoniae have identified numerous proteins with immunogenic potential
Proteins that perform housekeeping functions but have surface-exposed domains have been shown to elicit immune responses in other bacterial pathogens
Comparative evidence from related bacteria:
ATP synthase components have been identified as immunogenic in other bacterial species
In related Pasteurellaceae family members, membrane proteins have shown promise as vaccine candidates
The conservation of atpF across serotypes suggests it could potentially elicit cross-protective responses
To definitively establish the immunogenicity of atpF, additional studies are needed, including:
Direct ELISA or Western blot screening using sera from infected or vaccinated animals
Epitope mapping to identify potentially immunogenic regions
In vivo challenge studies using purified recombinant atpF as an immunogen
Recombinant atpF could be incorporated into novel vaccine strategies against A. pleuropneumoniae through several approaches:
Subunit vaccine development:
Recombinant atpF could be combined with other identified immunogens in a multi-component subunit vaccine
The high conservation of atpF across serotypes could potentially provide broader protection than serotype-specific antigens
Evidence from other studies suggests that conserved membrane proteins can elicit protective immunity against bacterial pathogens
Surface display technology:
Research has demonstrated the feasibility of using chimeric proteins to display antigens on bacterial surfaces
The ApfA stem (ApfAs) has been successfully used as an outer membrane anchor for displaying heterologous antigens
A similar approach could be used to display atpF epitopes, potentially enhancing their immunogenicity
DNA vaccine approaches:
Genetic immunization with atpF-encoding constructs could generate both humoral and cell-mediated immune responses
Previous work with A. pleuropneumoniae Apx toxins in DNA vaccines showed promise in eliciting immune responses and protective efficacy
Adjuvant and delivery system optimization:
Recombinant atpF could be formulated with appropriate adjuvants to enhance immune responses
Nanoparticle-based delivery systems could improve antigen presentation
Mucosal delivery strategies might enhance protection at the respiratory epithelium, the primary site of infection
For example, the adhesion protein ApfA has been shown to be highly conserved among different serotypes of A. pleuropneumoniae and demonstrated protective efficacy against challenges with different serotypes in mouse models. Its high conservation and immunogenicity made it a promising subunit vaccine candidate. Similar approaches could be explored with atpF if its immunogenicity is confirmed .
CRISPR-Cas9 gene editing offers powerful approaches for studying atpF function in A. pleuropneumoniae:
Precise genetic manipulation strategies:
Complete gene knockout: Construct CRISPR-Cas9 systems targeting atpF to create clean deletions for loss-of-function studies
Conditional knockdown: Use CRISPRi (CRISPR interference) with a catalytically inactive Cas9 (dCas9) to achieve tunable repression of atpF expression
Domain-specific mutations: Design repair templates with specific mutations to study the functional significance of different atpF domains
Reporter fusion: Insert fluorescent protein tags to monitor atpF expression and localization
Implementation considerations:
Delivery method: Electroporation of CRISPR-Cas9 components as ribonucleoprotein complexes often yields higher efficiency in difficult-to-transform bacteria
gRNA design: Target unique sequences within atpF with minimal off-target potential, preferably in the 5' region
Selection strategy: Design a two-step selection process to identify successful editing events
Confirmation methods: Use sequencing, RT-qPCR, and Western blotting to verify genetic and phenotypic changes
Experimental design for functional studies:
Create conditional atpF mutants (since complete deletion may be lethal)
Assess growth kinetics under aerobic and anaerobic conditions
Evaluate biofilm formation capacity
Determine changes in susceptibility to antimicrobials
Measure ATP production and proton gradient maintenance
Assess virulence in cell culture and animal models
Exploring genetic interactions:
Combine atpF mutations with disruptions in related energy metabolism genes
Create reporter strains to monitor how atpF expression responds to environmental changes
Investigate interactions with the ArcAB two-component regulatory system, which has been implicated in controlling metabolic adaptations necessary for virulence
Prior studies have successfully used transposon mutagenesis approaches like signature-tagged mutagenesis (STM) to identify A. pleuropneumoniae genes required for survival in vivo . CRISPR-Cas9 would allow for more precise genetic manipulations to extend these findings specifically for atpF.
Several structural biology approaches show promise for elucidating the three-dimensional structure of atpF and its interactions:
Cryo-electron microscopy (cryo-EM):
Most promising for intact ATP synthase complex visualization
Advantages:
Can resolve structures at near-atomic resolution (2-3 Å)
Requires less protein than crystallography
Preserves the protein in a near-native environment
Can capture different conformational states
Strategy:
Purify intact ATP synthase complex with mild detergents
Reconstitute in nanodiscs or amphipols to maintain stability
Use single-particle analysis and 3D reconstruction techniques
Apply focused refinement on the atpF region to improve local resolution
X-ray crystallography:
Challenging but potentially high-resolution approach
Implementation:
Express and purify stable fragments of atpF or the entire protein
Screen extensive crystallization conditions optimized for membrane proteins
Use lipidic cubic phase (LCP) or bicelle crystallization methods
Consider fusion proteins (e.g., T4 lysozyme) to aid crystallization
Employ heavy atom derivatives for phase determination
Nuclear Magnetic Resonance (NMR) spectroscopy:
Useful for dynamics and interaction studies
Application:
Solution NMR for soluble domains of atpF
Solid-state NMR for membrane-embedded regions
Use selective isotopic labeling (¹⁵N, ¹³C) to study specific regions
Perform titration experiments to map interaction interfaces with other ATP synthase subunits
Integrative structural biology approaches:
The membrane-embedded nature of atpF presents challenges for structural studies, but recent advances in membrane protein structural biology have overcome many of these obstacles. Techniques like single-particle cryo-EM have revolutionized the field by enabling visualization of large membrane protein complexes, making it particularly suitable for studying atpF in the context of the complete ATP synthase.
Comparative analysis of A. pleuropneumoniae atpF with homologs in other bacterial pathogens reveals important structural and functional relationships:
Sequence conservation patterns:
Structural features comparison:
The core structural elements of atpF are highly conserved across most bacterial species, including:
Two transmembrane helices
A cytoplasmic domain that interacts with the F₁ sector
Key residues involved in proton translocation
Minor variations occur in loop regions and in the C-terminal domain, which may reflect adaptation to different membrane environments
Functional conservation:
The primary function of atpF as part of ATP synthase is conserved across bacteria
Regulatory mechanisms controlling expression differ based on metabolic adaptations:
Post-translational modifications and protein-protein interactions may vary across species
Evolutionary insights:
Phylogenetic analysis places A. pleuropneumoniae atpF within the Pasteurellaceae family cluster
The high degree of conservation suggests strong selective pressure to maintain function
Membrane-spanning regions show higher conservation than peripheral domains
The protein exemplifies the balance between conservation of critical functional domains and adaptation to specific bacterial lifestyles
This comparison provides insight into conserved mechanisms of ATP synthesis while highlighting adaptations specific to A. pleuropneumoniae's pathogenic lifestyle and host environment. The findings suggest potential broad-spectrum antimicrobial targets within highly conserved regions of atpF.
Genomic and proteomic analyses provide valuable insights into atpF conservation and variation across A. pleuropneumoniae serotypes:
Genomic conservation analysis:
Complete genome sequencing of multiple A. pleuropneumoniae serotypes (including 5b strain L20 and serotype 3 strain JL03) demonstrates that atpF is part of the core genome
The atpF gene exists within a conserved operon structure encoding other ATP synthase subunits
Nucleotide sequence identity typically exceeds 97% across different serotypes
Non-synonymous substitutions are rare and primarily occur in non-critical regions, suggesting purifying selection
Proteomic expression patterns:
Proteomic studies show that atpF is consistently expressed across different serotypes
Expression levels may vary according to growth conditions, with potential upregulation under anaerobic conditions
Post-translational modifications appear to be conserved across serotypes
Membrane proteome analyses show atpF integration into the membrane fraction is consistent across strains
Variation hotspots:
Limited amino acid substitutions occur primarily in:
Evolutionary implications:
The high conservation suggests atpF is under strong selective pressure, likely due to its essential role in energy metabolism
Serotype-specific variations may reflect subtle adaptations to different host microenvironments
Unlike some virulence factors that show significant serotype variation, housekeeping proteins like atpF maintain high sequence conservation
The ATP synthase operon appears to evolve more slowly than regions containing phase-variable elements identified in A. pleuropneumoniae
These findings support the potential of atpF as a stable target across serotypes, whether for antimicrobial development or diagnostic purposes. The high conservation also means that recombinant proteins derived from one serotype would likely maintain structural similarity with other serotypes, supporting broader experimental applications.