Recombinant Actinobacillus pleuropneumoniae serotype 5b ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Actinobacillus pleuropneumoniae Serotype 5b ATP Synthase Subunit b (atpF)

The recombinant ATP synthase subunit b (atpF) from Actinobacillus pleuropneumoniae serotype 5b is a genetically engineered protein produced for research purposes. This subunit is a critical component of the F₀F₁ ATP synthase complex, which facilitates proton translocation and ATP synthesis in bacterial energy metabolism . The recombinant form is typically expressed in heterologous hosts such as E. coli or yeast systems, with purity levels exceeding 85% as determined by SDS-PAGE .

Experimental Uses

ApplicationDescription
SDS-PAGEUsed to assess protein purity and confirm expression in E. coli
Structural AnalysisPotential utility in X-ray crystallography or cryo-EM studies (not reported)
Antigen StudiesCould serve as a target for developing serotype-specific diagnostics

The recombinant atpF is primarily used for biochemical studies, though its role in vaccine development or diagnostic assays remains speculative. Serovar 5b is one of 19 recognized A. pleuropneumoniae serovars, with distinct antigenic profiles that could influence vaccine efficacy .

Comparative Genomic Insights

Genomic analyses of A. pleuropneumoniae reveal conserved ATP synthase subunits across serovars, emphasizing their critical role in bacterial physiology. The atpF gene is part of the core genome, shared among all sequenced strains, including serovars 1, 2, 3, 4, 5b, 6, 7, 9, 10, 11, 12, and 13 .

Limitations and Future Directions

While recombinant atpF provides a tool for studying ATP synthase mechanics, gaps remain in understanding its specific interactions with other subunits or regulatory proteins. For example:

  • Regulatory Interactions: ArcA, a two-component system regulator, modulates anaerobic metabolism in A. pleuropneumoniae, but its direct impact on atpF expression is unexplored .

  • Evolutionary Adaptation: Positive selection pressures on surface proteins in A. pleuropneumoniae suggest potential for adaptive changes in energy-related genes, though atpF has not been explicitly identified as a target .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order. We will prepare your order according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpF; APL_1650; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Target Names
atpF
Target Protein Sequence
MNLNATLIGQLIAFALFVAFCMKFVWPPLIKAIEERQANIANALASAEKAKQEQADSKAAADQEILKAKEEAQKIIDLATKRRNEILETVQAEAEIERQRIIEQGHAEVESERKRVQEELRQKVAALAVAGAEKIVGCSVDQAANNDIIDKLVAEL
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This subunit is a component of the F(0) channel, forming part of the peripheral stalk that connects F(1) to F(0).
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

How conserved is the atpF protein sequence across different Actinobacillus pleuropneumoniae serotypes?

The atpF protein sequence is highly conserved across different A. pleuropneumoniae serotypes, making it a stable target for research applications. Sequence alignments of atpF from serotypes 5b (strain L20), 7 (strain AP76), and 3 (strain JL03) reveal over 98% identity at the amino acid level .

Below is a comparison of atpF sequences from three different serotypes:

Serotype and StrainAmino Acid SequenceDifferences from 5b Strain
5b (L20)MNLNATLIGQLIAFALFVAFCMKFVWPPLIKAIEERQANIANALASAEKAKQEQADSKAAADQEILKAKEEAQKIIDLATKRRNEILETVQAEAEIERQRIIEQGHAEVESERKRVQEELRQKVAALAVAGAEKIVGCSVDQAANNDIIDKLVAELReference sequence
7 (AP76)MNLNATLIGQLIAFALFVAFCMKFVWPPLIKAIEERQANIANALASAEKAKQEQADSKAAADQEILKAKEEAQKIIDLATKRRNEILESVQAEAEIERQRIIEQGHAEVESERKRVQEELRQKVAALAVAGAEKIVGRSVDQAANNDIIDKLVAELPosition 127: T→S; Position 148: C→R
3 (JL03)[Similar with potential minor variations](Full sequence not provided in search results)

This high degree of conservation makes atpF a potentially useful target for cross-serotype studies and suggests its functional importance for bacterial survival, as essential proteins tend to show higher evolutionary conservation .

What are the optimal conditions for expression of recombinant Actinobacillus pleuropneumoniae serotype 5b atpF protein in E. coli?

The optimal expression of recombinant A. pleuropneumoniae serotype 5b atpF in E. coli requires careful consideration of several parameters:

Expression vector selection:

  • pET15b vector system has been successfully used for atpF expression, providing an N-terminal His-tag for purification

  • The vector selection should include a strong inducible promoter (e.g., T7) for controlled expression

E. coli strain considerations:

  • BL21(DE3) or derivatives are preferred for membrane protein expression

  • Strains with reduced protease activity (e.g., BL21(DE3)pLysS) can improve yield by minimizing degradation

Induction parameters:

  • Lower temperatures (16-25°C) during induction phase minimize inclusion body formation

  • IPTG concentration: 0.1-0.5 mM is typically sufficient

  • Induction at mid-log phase (OD₆₀₀ 0.6-0.8) generally yields better results

  • Extended induction times (16-20 hours) at lower temperatures may increase soluble protein yield

Media optimization:

  • Rich media (e.g., Terrific Broth) can enhance yield

  • Addition of 1% glucose can reduce basal expression and improve final yield

  • Supplementation with 0.5-1% glycerol can improve membrane protein folding

For membrane proteins like atpF, inclusion of membrane-mimicking environments (detergents or lipids) in the lysis buffer is critical for maintaining protein structure during extraction and purification processes .

What purification strategies have proven most effective for obtaining high-purity recombinant atpF protein suitable for structural and functional studies?

Purification of recombinant atpF protein to high purity for structural and functional studies requires a multi-step approach:

Initial extraction:

  • Cell lysis under native conditions using mild detergents (e.g., n-dodecyl β-D-maltoside at 1-2%) to solubilize membrane proteins without denaturation

  • Addition of DNase I (5-10 μg/ml) and protease inhibitors to protect the target protein during extraction

Affinity chromatography:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or TALON resins for His-tagged atpF

  • Gradual imidazole gradient (20-250 mM) to minimize co-elution of contaminants

  • Extended washing steps (10-15 column volumes) with low imidazole (20-40 mM) to remove weakly bound proteins

Secondary purification:

  • Size exclusion chromatography to separate properly folded protein from aggregates

  • Ion-exchange chromatography as an orthogonal purification step

  • Consideration of specialized techniques like hydroxyapatite chromatography for removing endotoxins if the protein will be used in immunological studies

Quality assessment:

  • SDS-PAGE analysis (>85-90% purity is typically achieved)

  • Western blot confirmation of identity

  • Dynamic light scattering to confirm monodispersity

  • Circular dichroism to verify proper secondary structure

For structural studies, additional detergent screening and buffer optimization may be required to identify conditions that maintain protein stability while being compatible with the intended structural biology technique (X-ray crystallography, NMR, or cryo-EM) .

What is the functional significance of ATP synthase subunit b (atpF) in Actinobacillus pleuropneumoniae pathogenesis?

ATP synthase subunit b (atpF) plays several critical roles in A. pleuropneumoniae pathogenesis:

Energy metabolism during infection:

  • AtpF is an essential component of the F₀F₁-ATP synthase complex, which is crucial for ATP generation in bacterial cells

  • During infection, A. pleuropneumoniae must adapt to microaerobic or anaerobic conditions in the host's respiratory tract, making efficient energy production vital for survival

  • The ArcAB two-component system, which regulates metabolic adaptation under anaerobic conditions, influences ATP synthase expression, suggesting that coordinated energy production is essential for virulence

Adaptation to host environment:

  • A. pleuropneumoniae must adapt to the restricted oxygen availability in host tissues

  • Studies have shown that mutants with impaired energy metabolism (including ATP synthase components) often show attenuated virulence in infection models

  • The F₀F₁-ATP synthase may function in reverse under certain conditions to maintain proton motive force, crucial for various virulence-associated transport systems

Potential immunogenic role:

  • Membrane-associated proteins like atpF may be exposed on the cell surface and recognized by the host immune system

  • Proteomic analyses of A. pleuropneumoniae have identified ATP synthase components among the proteins that may interact with the host

Research on the fumarate reductase system of A. pleuropneumoniae has demonstrated that energy metabolism components are critical for virulence. When the fumarate reductase system was disrupted, A. pleuropneumoniae showed significantly attenuated virulence in a pig aerosol infection model. This finding suggests that other components of energy metabolism, including ATP synthase, may similarly contribute to pathogenesis .

How does ATP synthase function in the context of Actinobacillus pleuropneumoniae's adaptation to anaerobic conditions in host tissues?

A. pleuropneumoniae must adapt to anaerobic conditions within host tissues, and ATP synthase plays a pivotal role in this adaptation:

Metabolic adaptation:

  • Under anaerobic conditions, A. pleuropneumoniae shifts from aerobic respiration to alternative respiratory pathways

  • The ArcAB two-component system acts as a global regulator of this metabolic shift, affecting expression of ATP synthase components

  • ATP synthase continues to function in anaerobic respiration by coupling proton translocation to ATP synthesis

Integration with reductive pathways:

  • Research has shown that ArcA negatively regulates the expression of enzymes that consume metabolic intermediates during fumarate synthesis

  • Simultaneously, expression of glycerol-3-phosphate dehydrogenase—a component providing reduction equivalents to fumarate reductase—is upregulated

  • This coordinated regulation suggests that anaerobic energy production is tightly coupled with metabolic pathways, with ATP synthase playing a central role in energy capture

Experimental evidence:

  • Fumarate reductase deletion mutants of A. pleuropneumoniae showed significant attenuation in a pig aerosol infection model

  • This finding suggests that the anaerobic respiratory chain, including ATP synthase, is crucial for virulence

  • The bacterium appears to use fumarate respiration not only for energy generation but also for providing metabolic intermediates via the reductive branch of the citric acid cycle

What is known about the immunogenicity of atpF in the context of Actinobacillus pleuropneumoniae infections?

The immunogenicity of atpF in A. pleuropneumoniae infections has not been extensively characterized compared to other bacterial antigens, but several lines of evidence suggest its potential immunological relevance:

Immunoproteomic findings:

  • Comprehensive immunoproteomic analyses of A. pleuropneumoniae have identified numerous immunoreactive proteins

  • While atpF is not consistently among the most prominently identified antigens, other membrane-associated proteins have shown strong immunoreactivity in sera from infected animals

  • Immunoproteomic approaches have identified 42 immunoreactive spots representing 32 different proteins from APP serotype 1, including several membrane proteins with properties similar to atpF

Surface exposure and accessibility:

  • As a component of the membrane-bound ATP synthase complex, portions of the atpF protein may be exposed on the bacterial surface

  • Outer membrane proteome analyses of A. pleuropneumoniae have identified numerous proteins with immunogenic potential

  • Proteins that perform housekeeping functions but have surface-exposed domains have been shown to elicit immune responses in other bacterial pathogens

Comparative evidence from related bacteria:

  • ATP synthase components have been identified as immunogenic in other bacterial species

  • In related Pasteurellaceae family members, membrane proteins have shown promise as vaccine candidates

  • The conservation of atpF across serotypes suggests it could potentially elicit cross-protective responses

To definitively establish the immunogenicity of atpF, additional studies are needed, including:

  • Direct ELISA or Western blot screening using sera from infected or vaccinated animals

  • Epitope mapping to identify potentially immunogenic regions

  • In vivo challenge studies using purified recombinant atpF as an immunogen

How might recombinant atpF be incorporated into novel vaccine strategies against Actinobacillus pleuropneumoniae?

Recombinant atpF could be incorporated into novel vaccine strategies against A. pleuropneumoniae through several approaches:

Subunit vaccine development:

  • Recombinant atpF could be combined with other identified immunogens in a multi-component subunit vaccine

  • The high conservation of atpF across serotypes could potentially provide broader protection than serotype-specific antigens

  • Evidence from other studies suggests that conserved membrane proteins can elicit protective immunity against bacterial pathogens

Surface display technology:

  • Research has demonstrated the feasibility of using chimeric proteins to display antigens on bacterial surfaces

  • The ApfA stem (ApfAs) has been successfully used as an outer membrane anchor for displaying heterologous antigens

  • A similar approach could be used to display atpF epitopes, potentially enhancing their immunogenicity

DNA vaccine approaches:

  • Genetic immunization with atpF-encoding constructs could generate both humoral and cell-mediated immune responses

  • Previous work with A. pleuropneumoniae Apx toxins in DNA vaccines showed promise in eliciting immune responses and protective efficacy

Adjuvant and delivery system optimization:

  • Recombinant atpF could be formulated with appropriate adjuvants to enhance immune responses

  • Nanoparticle-based delivery systems could improve antigen presentation

  • Mucosal delivery strategies might enhance protection at the respiratory epithelium, the primary site of infection

For example, the adhesion protein ApfA has been shown to be highly conserved among different serotypes of A. pleuropneumoniae and demonstrated protective efficacy against challenges with different serotypes in mouse models. Its high conservation and immunogenicity made it a promising subunit vaccine candidate. Similar approaches could be explored with atpF if its immunogenicity is confirmed .

How can CRISPR-Cas9 gene editing be utilized to study the function of atpF in Actinobacillus pleuropneumoniae?

CRISPR-Cas9 gene editing offers powerful approaches for studying atpF function in A. pleuropneumoniae:

Precise genetic manipulation strategies:

  • Complete gene knockout: Construct CRISPR-Cas9 systems targeting atpF to create clean deletions for loss-of-function studies

  • Conditional knockdown: Use CRISPRi (CRISPR interference) with a catalytically inactive Cas9 (dCas9) to achieve tunable repression of atpF expression

  • Domain-specific mutations: Design repair templates with specific mutations to study the functional significance of different atpF domains

  • Reporter fusion: Insert fluorescent protein tags to monitor atpF expression and localization

Implementation considerations:

  • Delivery method: Electroporation of CRISPR-Cas9 components as ribonucleoprotein complexes often yields higher efficiency in difficult-to-transform bacteria

  • gRNA design: Target unique sequences within atpF with minimal off-target potential, preferably in the 5' region

  • Selection strategy: Design a two-step selection process to identify successful editing events

  • Confirmation methods: Use sequencing, RT-qPCR, and Western blotting to verify genetic and phenotypic changes

Experimental design for functional studies:

  • Create conditional atpF mutants (since complete deletion may be lethal)

  • Assess growth kinetics under aerobic and anaerobic conditions

  • Evaluate biofilm formation capacity

  • Determine changes in susceptibility to antimicrobials

  • Measure ATP production and proton gradient maintenance

  • Assess virulence in cell culture and animal models

Exploring genetic interactions:

  • Combine atpF mutations with disruptions in related energy metabolism genes

  • Create reporter strains to monitor how atpF expression responds to environmental changes

  • Investigate interactions with the ArcAB two-component regulatory system, which has been implicated in controlling metabolic adaptations necessary for virulence

Prior studies have successfully used transposon mutagenesis approaches like signature-tagged mutagenesis (STM) to identify A. pleuropneumoniae genes required for survival in vivo . CRISPR-Cas9 would allow for more precise genetic manipulations to extend these findings specifically for atpF.

What structural biology approaches are most promising for elucidating the three-dimensional structure of atpF and its interactions within the ATP synthase complex?

Several structural biology approaches show promise for elucidating the three-dimensional structure of atpF and its interactions:

Cryo-electron microscopy (cryo-EM):

  • Most promising for intact ATP synthase complex visualization

  • Advantages:

    • Can resolve structures at near-atomic resolution (2-3 Å)

    • Requires less protein than crystallography

    • Preserves the protein in a near-native environment

    • Can capture different conformational states

  • Strategy:

    • Purify intact ATP synthase complex with mild detergents

    • Reconstitute in nanodiscs or amphipols to maintain stability

    • Use single-particle analysis and 3D reconstruction techniques

    • Apply focused refinement on the atpF region to improve local resolution

X-ray crystallography:

  • Challenging but potentially high-resolution approach

  • Implementation:

    • Express and purify stable fragments of atpF or the entire protein

    • Screen extensive crystallization conditions optimized for membrane proteins

    • Use lipidic cubic phase (LCP) or bicelle crystallization methods

    • Consider fusion proteins (e.g., T4 lysozyme) to aid crystallization

    • Employ heavy atom derivatives for phase determination

Nuclear Magnetic Resonance (NMR) spectroscopy:

  • Useful for dynamics and interaction studies

  • Application:

    • Solution NMR for soluble domains of atpF

    • Solid-state NMR for membrane-embedded regions

    • Use selective isotopic labeling (¹⁵N, ¹³C) to study specific regions

    • Perform titration experiments to map interaction interfaces with other ATP synthase subunits

Integrative structural biology approaches:

The membrane-embedded nature of atpF presents challenges for structural studies, but recent advances in membrane protein structural biology have overcome many of these obstacles. Techniques like single-particle cryo-EM have revolutionized the field by enabling visualization of large membrane protein complexes, making it particularly suitable for studying atpF in the context of the complete ATP synthase.

How does Actinobacillus pleuropneumoniae atpF compare structurally and functionally with homologous proteins in other bacterial pathogens?

Comparative analysis of A. pleuropneumoniae atpF with homologs in other bacterial pathogens reveals important structural and functional relationships:

Sequence conservation patterns:

Structural features comparison:

  • The core structural elements of atpF are highly conserved across most bacterial species, including:

    • Two transmembrane helices

    • A cytoplasmic domain that interacts with the F₁ sector

    • Key residues involved in proton translocation

  • Minor variations occur in loop regions and in the C-terminal domain, which may reflect adaptation to different membrane environments

Functional conservation:

  • The primary function of atpF as part of ATP synthase is conserved across bacteria

  • Regulatory mechanisms controlling expression differ based on metabolic adaptations:

    • In facultative anaerobes like A. pleuropneumoniae, expression is influenced by oxygen availability and the ArcAB system

    • In obligate aerobes, different regulatory systems control expression

  • Post-translational modifications and protein-protein interactions may vary across species

Evolutionary insights:

  • Phylogenetic analysis places A. pleuropneumoniae atpF within the Pasteurellaceae family cluster

  • The high degree of conservation suggests strong selective pressure to maintain function

  • Membrane-spanning regions show higher conservation than peripheral domains

  • The protein exemplifies the balance between conservation of critical functional domains and adaptation to specific bacterial lifestyles

This comparison provides insight into conserved mechanisms of ATP synthesis while highlighting adaptations specific to A. pleuropneumoniae's pathogenic lifestyle and host environment. The findings suggest potential broad-spectrum antimicrobial targets within highly conserved regions of atpF.

What can genomic and proteomic analyses reveal about the conservation and variation of atpF across different Actinobacillus pleuropneumoniae serotypes?

Genomic and proteomic analyses provide valuable insights into atpF conservation and variation across A. pleuropneumoniae serotypes:

Genomic conservation analysis:

  • Complete genome sequencing of multiple A. pleuropneumoniae serotypes (including 5b strain L20 and serotype 3 strain JL03) demonstrates that atpF is part of the core genome

  • The atpF gene exists within a conserved operon structure encoding other ATP synthase subunits

  • Nucleotide sequence identity typically exceeds 97% across different serotypes

  • Non-synonymous substitutions are rare and primarily occur in non-critical regions, suggesting purifying selection

Proteomic expression patterns:

  • Proteomic studies show that atpF is consistently expressed across different serotypes

  • Expression levels may vary according to growth conditions, with potential upregulation under anaerobic conditions

  • Post-translational modifications appear to be conserved across serotypes

  • Membrane proteome analyses show atpF integration into the membrane fraction is consistent across strains

Variation hotspots:

  • Limited amino acid substitutions occur primarily in:

    • C-terminal regions (positions 127 and 148 between serotypes 5b and 7)

    • Surface-exposed loops that don't directly participate in core functions

    • Regions facing the lipid bilayer that may adapt to membrane composition differences

Evolutionary implications:

  • The high conservation suggests atpF is under strong selective pressure, likely due to its essential role in energy metabolism

  • Serotype-specific variations may reflect subtle adaptations to different host microenvironments

  • Unlike some virulence factors that show significant serotype variation, housekeeping proteins like atpF maintain high sequence conservation

  • The ATP synthase operon appears to evolve more slowly than regions containing phase-variable elements identified in A. pleuropneumoniae

These findings support the potential of atpF as a stable target across serotypes, whether for antimicrobial development or diagnostic purposes. The high conservation also means that recombinant proteins derived from one serotype would likely maintain structural similarity with other serotypes, supporting broader experimental applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.