Recombinant Actinobacillus pleuropneumoniae serotype 5b Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Genetic and Protein Characteristics

DsbB in A. pleuropneumoniae is encoded by the gene dsbB (locus tag: APL_0321) and functions as a disulfide oxidoreductase. The recombinant form of DsbB from serotype 5b (strain L20) has been produced for research and diagnostic purposes. Key features include:

PropertyDetails
UniProt IDA3MZ39
Gene NamedsbB
Protein Length179 amino acids (full-length)
Molecular Weight~22 kDa (calculated)
Expression SystemRecombinant production in E. coli
Sequence MotifsTransmembrane domains, quinone-binding sites
Functional RoleReoxidizes DsbA to maintain disulfide bond formation in periplasmic proteins

Functional Role in Bacterial Physiology

DsbB interacts with DsbA to maintain the oxidative folding of secreted proteins. This system is coupled to the electron transport chain via ubiquinone/menaquinone, linking energy metabolism to virulence factor assembly. Key findings include:

  • Pleiotropic Effects: Mutations in dsbA (a partner of DsbB) reduce virulence in A. pleuropneumoniae by >10-fold in vivo without affecting in vitro growth, indicating DsbB’s indirect role in pathogenicity .

  • Substrate Range: DsbB-DsbA facilitates folding of:

    • RTX toxins (e.g., ApxI–IV) critical for hemolysis and cytotoxicity .

    • Outer membrane proteins (OMPs) involved in nutrient uptake and biofilm formation .

    • Type III secretion system components .

Virulence Attenuation

  • Disruption of dsbB or dsbA impairs disulfide-dependent proteins, including adhesins and iron acquisition systems (e.g., TbpA/TbpB transferrin receptors) .

  • Mutants show reduced survival in competitive index assays during acute porcine infections .

Biofilm Formation

  • DsbB indirectly influences biofilm-associated proteins (e.g., PGA polysaccharide biosynthesis via pgaABC genes) .

  • Biofilm formation is critical for chronic infections and antibiotic resistance .

Vaccine Development

  • While DsbB itself is not yet a vaccine target, recombinant outer membrane proteins (rOMPs) are key components of experimental vaccines. For example:

    • A multicomponent vaccine (rApxI–III + rOMP) provided cross-protection against multiple A. pleuropneumoniae serotypes .

    • Surface-exposed proteins like OmpP2B and LamB, dependent on DsbB for folding, are under investigation .

Diagnostic Tools

  • Recombinant DsbB is used in ELISA kits (e.g., CSB-CF386714AUF) for serotype-specific antibody detection .

Comparative Analysis of Dsb Systems

OrganismDsbB HomologRole in VirulenceReference
A. pleuropneumoniaeDsbB (APL_0321)Essential for RTX toxin stability, iron uptake
Escherichia coliDsbBRedox control of periplasmic proteins
Vibrio choleraeDsbBRequired for cholera toxin secretion

Future Directions

  • Structural Studies: Resolving DsbB’s crystal structure could aid in designing inhibitors targeting redox pathways .

  • Host-Pathogen Interactions: Investigating DsbB’s role in oxidative stress responses during macrophage infection .

  • Multivalent Vaccines: Exploring DsbB as an adjuvant to enhance immunity against OMPs .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format we currently have in stock, we are happy to accommodate any specific format requirements you may have. Please indicate your preferred format in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary based on your purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing of the product is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point for your own preparations.
Shelf Life
The shelf life of our products is influenced by various factors such as storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses to minimize freeze-thaw cycles.
Tag Info
The specific tag type will be determined during the manufacturing process.
We will choose the tag type during production. If you have a specific tag type preference, please inform us, and we will prioritize its development for your product.
Synonyms
dsbB; APL_0321; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Target Names
dsbB
Target Protein Sequence
MLSYFKELSLNRTAWLLLAFVAFALEASAIYFQYGMGLVPCVMCVYERLAIFGLLIAGLV GAISPRFFLTRWLALLLWGFSAFKGLALAIKHHDYQANPSPWNQCEFKPEFPQTMPFDQW FPSIFAPGPVNCSEKQWEMFGLGMPEWLILAFSIFALMFVIVLLSQFKRAKPQYRSVFR
Uniprot No.

Target Background

Function
This protein is essential for disulfide bond formation in certain periplasmic proteins. It achieves this by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does dsbB function in the disulfide bond formation pathway?

DsbB functions as a critical enzyme in the disulfide bond formation pathway by reoxidizing the DsbA protein, which directly catalyzes disulfide bond formation in substrate proteins. The reaction mechanism involves electron transfer through a series of thiol-disulfide exchange reactions. Specifically, dsbB has developed elaborate conformational dynamism to oxidize DsbA for continuous protein disulfide bond formation.

The reaction occurs in the following order:

  • DsbB forms a charge transfer (CT) complex with ubiquinone (UQ) near its reaction center

  • A covalent Cys44-UQ bond forms, stabilized by Arg48

  • This induces a nucleophilic attack by Cys41

  • The resulting disulfide is transferred to DsbA

  • The Cys104-Cys130 pair in dsbB is then reoxidized by UQ

This electron flow ensures continuous function of the disulfide bond formation machinery in the periplasmic space.

What are the optimal storage and reconstitution conditions for recombinant dsbB protein?

For optimal research outcomes, proper storage and handling of recombinant dsbB protein is essential. The recommended storage protocol includes:

ParameterRecommendation
Storage temperature-20°C to -80°C upon receipt
Storage formLyophilized powder
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Long-term storageAdd 5-50% glycerol (final concentration) and aliquot
Freeze-thaw cyclesAvoid repeated cycles; keep working aliquots at 4°C for up to one week

Prior to opening, it is recommended to briefly centrifuge the vial to bring contents to the bottom. The reconstituted protein should be properly aliquoted to prevent protein degradation from repeated freeze-thaw cycles .

How do mutations in the horizontal helix region affect dsbB catalytic function?

The horizontal helix region of dsbB plays a critical role in its catalytic function. Research has shown that specific mutations in this region significantly impair dsbB activity without necessarily affecting its structural integrity. In particular:

  • Simultaneous replacement of Leu114 and Leu116 with charged residues or proline significantly increases the proportion of reduced DsbA in vivo, indicating compromised dsbB function

  • Alanine substitutions at these positions have minimal effect

  • More extensive mutations involving Leu114, Leu116, Val120, Val123, and Phe124 result in severe functional defects

  • Most of these mutants maintain similar cellular accumulation levels to wild-type dsbB

Functional studies demonstrate that the membrane-bound horizontal helix restricts the movement of the two catalytically essential P2 cysteines, effectively functioning as a ratchet that drives the physiological thiol-disulfide exchange reactions. This proper organization is also important for oxidation specificity, preventing dsbB from effectively oxidizing dimeric DsbC protein .

What experimental approaches can resolve the dynamic nature of dsbB-DsbA interactions?

Investigating the dynamic interactions between dsbB and DsbA requires sophisticated experimental approaches. Based on successful research methodologies:

  • Crystallography of Protein Complexes: Crystallization of the DsbB-Fab complex using space group C2 symmetry has yielded structural insights at 3.4 Å resolution. This approach involves:

    • Preparation of a DsbB(Cys41Ser)-Fab complex of 1:1 stoichiometry by size-exclusion chromatography

    • X-ray diffraction data collection using synchrotron radiation (e.g., SPring-8 beamline)

    • Phase determination by molecular replacement

    • Model building and refinement

  • Mutagenesis Studies: Systematic mutation of specific residues followed by functional assessment:

    • Site-directed mutagenesis of key residues in the horizontal helix

    • Complementation tests in dsbB-null cells

    • Analysis of in vivo redox states of DsbA

    • In vitro assays using membrane fractions to confirm mutational effects

  • Quinone-Free Assays: To isolate the direct DsbA-oxidizing ability of dsbB:

    • Preparation of quinone-free dsbB

    • Monitoring oxidation of reduced DsbA in 1:1 stoichiometric reactions

    • Comparative analysis of wild-type versus mutant dsbB variants

These approaches collectively provide insights into the conformational dynamics essential for dsbB function.

How does the ubiquinone interaction site influence dsbB redox activity?

The ubiquinone (UQ) interaction site is central to dsbB's redox activity. Located around the N-terminal end of TM2, near the aligned side chains of Cys41, Cys44, and Arg48, this site forms the reaction center for disulfide bond manufacture. Key aspects of this interaction include:

  • Charge Transfer Complex Formation: Cys44 forms a charge transfer (CT) complex with UQ, which is electrostatically stabilized by Arg48's guanidinium group

  • Covalent Adduct Formation: The Cys44-UQ covalent bond subsequently induces a nucleophilic attack by Cys41

  • Redox Persistence: Even mutations that impair normal catalytic function maintain the ability to generate disulfide bonds through UQ interaction, as evidenced by their resistance to reduction with 5 mM DTT

  • Quinone-Independent Activity: Wild-type dsbB can oxidize approximately 40% of reduced DsbA in 1:1 stoichiometric reactions even without UQ, while variants with inactivating mutations lose this ability

Understanding this interaction has significant implications for addressing bacterial resistance mechanisms, as the dsbB-UQ interaction represents a potential target for novel antimicrobial strategies.

What experimental design considerations are crucial for assessing dsbB mutant functionality?

When designing experiments to assess dsbB mutant functionality, several critical methodological considerations should be implemented:

  • Proper Controls:

    • Include positive controls (wild-type dsbB) and negative controls (dsbB-null cells)

    • Design appropriate experimental controls to ensure reliability and validity of results

    • Implement multiple technical and biological replicates to account for experimental variation

  • Variable Selection and Measurement:

    • Independent variables: mutated residues, environmental conditions

    • Dependent variables: DsbA redox state, dsbB activity measurements

    • Control variables: expression levels, cellular conditions

  • Multi-level Assessment:

    • In vivo complementation assays in dsbB-null cells

    • In vitro biochemical assays using purified components

    • Structural analysis when possible

    • Correlation of structural changes with functional outcomes

  • Quantitative Analysis:

    • Use densitometry for analyzing redox state distributions

    • Apply statistical methods to determine significance of observed differences

    • Ensure sample sizes are sufficient for statistical power

This comprehensive approach enables reliable determination of structure-function relationships in dsbB variants.

How can researchers effectively distinguish between correlation and causation when analyzing dsbB mutation effects?

Distinguishing between correlation and causation in dsbB mutation studies requires rigorous experimental design and analysis:

By implementing these approaches, researchers can move beyond correlative observations to establish causal relationships between specific dsbB structural elements and their functions.

What sampling and data collection methods yield the most reliable results when studying dsbB activity?

To obtain reliable results when studying dsbB activity, researchers should implement the following sampling and data collection methods:

  • Protein Preparation and Quality Control:

    • Ensure protein purity >90% as determined by SDS-PAGE

    • Verify protein identity through mass spectrometry

    • Confirm proper folding through circular dichroism or other structural techniques

    • Use freshly prepared samples when possible to avoid degradation

  • Activity Assay Design:

    • Implement multiple complementary assay types (e.g., in vivo redox state analysis, in vitro oxidation assays)

    • Include time-course measurements to capture reaction kinetics

    • Use concentration gradients to determine enzyme kinetic parameters

    • Maintain consistent reaction conditions across experimental replicates

  • Data Collection Parameters:

    ParameterRecommendation
    Technical replicatesMinimum of 3 per experimental condition
    Biological replicatesMinimum of 3 independent preparations
    Control samplesInclude in each experimental batch
    Time pointsMultiple points to establish reaction rates
    Measurement methodsUse multiple detection methods when possible
  • Statistical Analysis:

    • Apply appropriate statistical tests based on data distribution

    • Account for multiple comparisons when analyzing numerous mutants

    • Report effect sizes along with p-values

    • Provide complete datasets rather than only processed results

These methodological approaches ensure robust, reproducible results when investigating the complex activity patterns of dsbB.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.