Recombinant Actinobacillus pleuropneumoniae serotype 5b Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Actinobacillus pleuropneumoniae Serotype 5b Fumarate Reductase Subunit D (frdD)

Recombinant Actinobacillus pleuropneumoniae serotype 5b Fumarate Reductase Subunit D (frdD) is a genetically engineered protein component of the fumarate reductase (Frd) enzyme complex. This complex plays a critical role in anaerobic respiration, enabling the bacterium to persist in low-oxygen environments such as swine lung tissues . The recombinant form is produced in heterologous expression systems (e.g., E. coli, yeast, or mammalian cells) for research and diagnostic applications .

Genetic and Molecular Features

  • Gene Name: frdD (APL_RS08065) .

  • Protein Function: Anchors the catalytic FrdAB subunits to the bacterial membrane, facilitating electron transfer during fumarate reduction .

  • Subunit Composition: The Frd complex comprises four subunits:

    • FrdA: Flavoprotein with a covalently bound FAD cofactor.

    • FrdB: Iron-sulfur protein with [2Fe-2S], [4Fe-4S], and [3Fe-4S] clusters.

    • FrdC/D: Membrane-anchoring subunits critical for quinone binding and redox coupling .

Recombinant Production

Recombinant frdD is synthesized with ≥85% purity (verified by SDS-PAGE) and is available in multiple expression systems :

SerotypeHost SystemPurityApplication
5bE. coli, Yeast, Mammalian≥85%Pathogenesis studies
3Cell-free expression≥85%Structural analysis
7Baculovirus, Mammalian≥85%Vaccine development

Anaerobic Adaptation and Virulence

  • Metabolic Role: Frd enables fumarate respiration under anaerobic conditions, generating ATP and metabolic intermediates (e.g., succinate) .

  • Virulence Attenuation: Deletion of the frdABCD operon in A. pleuropneumoniae significantly reduces lung lesion severity in pigs (P ≤ 0.05), confirming its role in pathogenicity .

StrainLung Lesion SeverityClinical Outcome
Wild-type (WT)Severe fibrinous pleuropneumoniaHigh mortality, abscess formation
ΔfrdABCD mutantMild bronchiolo-interstitial pneumoniaReduced morbidity

Regulatory Mechanisms

  • The Frd complex is regulated by the ArcAB two-component system, which represses oxidative metabolic pathways under anaerobic conditions .

  • Downregulation of capsular polysaccharide genes during host cell adhesion correlates with increased biofilm formation via pgaBC upregulation .

Vaccine Development

  • Subunit Vaccines: Recombinant frdD has been tested in multicomponent vaccines alongside Apx toxins (e.g., ApxI, ApxII). These vaccines show cross-protection against multiple A. pleuropneumoniae serotypes .

  • Antibody Response: Vaccinated pigs exhibit elevated IgG titers and reduced bacterial load in challenge studies .

Diagnostic Tools

  • Recombinant frdD is used in ELISA assays to detect A. pleuropneumoniae-specific antibodies in swine herds, aiding in seroprevalence monitoring .

Enzymatic Activity

  • Fumarate Reductase Activity: Wild-type Frd exhibits a turnover number of 27,700 min⁻¹ using reduced benzyl viologen as an electron donor .

  • SDH Activity: The Frd complex also functions as a succinate dehydrogenase (SDH) under aerobic conditions, though with reduced efficiency (~15–20% of wild-type activity in certain mutants) .

Mutant Phenotypes

  • Pro159Gln Mutation: Disrupts quinone binding, reducing SDH activity by 80% and impairing aerobic growth .

  • ΔarcA Mutants: Show diminished Frd expression, leading to metabolic dysregulation and attenuated virulence .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
frdD; APL_1526; Fumarate reductase subunit D; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Target Names
frdD
Target Protein Sequence
MNKQDPKRSNEPPVWLMFSAGGTISAICFPVLLLILGVLLPLGLVPVENIVAFAHTWFGK LVILAVTIFPMWAGMHRVHHGLHDLKIHFPAGGWVFYGLSALYSVIVFFAVIAL
Uniprot No.

Target Background

Function
Anchors the catalytic components of the fumarate reductase complex to the cell membrane and binds quinones.
Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of the fumarate reductase complex in Actinobacillus pleuropneumoniae?

The fumarate reductase enzyme complex (FrdABCD) in A. pleuropneumoniae serves as a terminal electron acceptor in an electron transfer reaction of the respiratory chain. This complex is crucial for bacterial energy production under anaerobic conditions, catalyzing the reduction of fumarate to succinate. The process is typically linked with glycerol-3-phosphate dehydrogenase through a simple electron transport chain, transferring reduction equivalents directly from glycerol-3-phosphate to fumarate and generating a proton gradient in the process .

Research has demonstrated that this metabolic pathway is essential for A. pleuropneumoniae virulence, allowing the bacterium to adapt to the oxygen-limited environment in infected lung tissue. The complex not only provides energy via fumarate respiration but also supplies succinate and other essential metabolic intermediates through the reductive branch of the citric acid cycle .

What is the role of FrdD specifically within the fumarate reductase complex?

FrdD functions as one of the four subunits (FrdA, FrdB, FrdC, and FrdD) of the fumarate reductase complex. While FrdA contains the catalytic site for fumarate reduction and FrdB contains iron-sulfur clusters for electron transfer, FrdC and FrdD are membrane anchor proteins that secure the complex to the cytoplasmic membrane .

FrdD specifically contributes to the proper localization and anchoring of the functional complex within the bacterial membrane, ensuring efficient electron transport and energy generation. This membrane integration is critical for coupling the reduction of fumarate with proton translocation across the membrane, which generates the proton motive force needed for ATP synthesis under anaerobic conditions .

How does the ArcA regulatory system influence fumarate reductase expression?

The ArcAB two-component system plays a crucial role in metabolic adaptation of A. pleuropneumoniae in response to anaerobic conditions. Research has shown that ArcA functions as a major metabolic modulator, coordinating the regulation of genes involved in the pathway leading to fumarate synthesis .

While the transcription of genes encoding the fumarate reductase complex (frdABCD) appears to be constitutively expressed rather than directly regulated by ArcA, the ArcA system indirectly enhances fumarate reductase activity by:

This regulatory network ensures efficient anaerobic energy production, which is essential for A. pleuropneumoniae persistence in the oxygen-limited environment of infected lung tissue.

What methods can be used to generate recombinant A. pleuropneumoniae FrdD for research purposes?

Producing recombinant A. pleuropneumoniae FrdD protein requires several methodological steps:

DNA Amplification and Cloning:

  • PCR amplification of the frdD gene from A. pleuropneumoniae serotype 5b genomic DNA using specific primers that incorporate appropriate restriction sites

  • Restriction digestion and ligation of the amplified fragment into an expression vector (such as pET or pGEX systems)

  • Transformation of the recombinant plasmid into an E. coli cloning strain for verification

Expression System Optimization:

  • Transform the verified construct into an E. coli expression strain (BL21(DE3) or derivatives)

  • Test expression conditions (temperature, IPTG concentration, induction time)

  • For membrane proteins like FrdD, consider specialized expression systems designed for membrane proteins, such as C41(DE3) or C43(DE3) strains

Protein Purification Strategy:

  • Extract membrane fractions using differential centrifugation

  • Solubilize the membrane protein using appropriate detergents

  • Purify using affinity chromatography based on incorporated tags (His-tag, GST, etc.)

  • Perform additional purification steps such as ion exchange or size exclusion chromatography

For functional studies, co-expression with other fumarate reductase subunits may be necessary to ensure proper folding and activity.

How can a fumarate reductase deletion mutant be constructed and validated?

Construction and validation of an A. pleuropneumoniae fumarate reductase deletion mutant can follow this methodology, based on previously successful approaches:

Construction Process:

  • Amplify DNA fragments (~1,300 bp) located upstream and downstream of the target deletion region using specific primers

  • Clone these fragments into appropriate vectors (e.g., pCR2.1-TOPO for the downstream fragment)

  • Perform restriction digestion with enzymes like BsmBI and PspOMI

  • Ligate the fragments to create a construct with a truncated frdA gene

  • Transfer the truncated gene construct into a suicide vector (e.g., pEMOC2)

  • Introduce the resulting plasmid into A. pleuropneumoniae via conjugation with an appropriate E. coli donor strain (e.g., β2155)

Validation Methods:

  • PCR screening to identify colonies with the correct genetic profile

  • Southern blotting to confirm the deletion

  • DNA sequencing of the recombination site

  • Pulsed-field gel electrophoresis to confirm the absence of genomic rearrangements

  • Enzymatic assay to verify the fumarate reductase-negative phenotype:

    • Measure absorbance at 340 nm in a solution containing sodium fumarate, NADH, and Tris (pH 7.3)

    • Compare NADH consumption between wild-type, mutant, and complemented strains

  • Genetic complementation in trans with a plasmid containing the intact gene to restore fumarate reductase activity

This comprehensive validation process ensures that the observed phenotypes are specifically due to the targeted deletion.

What analytical techniques can be used to assess FrdD protein expression and localization?

Several analytical techniques can be employed to assess FrdD protein expression and localization:

Expression Analysis:

  • Western blotting using specific antibodies against FrdD or attached epitope tags

  • Mass spectrometry for protein identification and quantification

  • Two-dimensional difference gel electrophoresis (2D DIGE) for comparative proteomic analysis

  • RNA analysis techniques (RT-PCR, RNA-Seq) to assess transcriptional expression

Localization Studies:

  • Cell fractionation to separate cytoplasmic, periplasmic, and membrane fractions

  • Membrane protein extraction using detergents

  • Immunofluorescence microscopy using labeled antibodies

  • Electron microscopy with immunogold labeling

  • Fluorescent protein fusion constructs to visualize localization in live cells

Functional Association Studies:

  • Co-immunoprecipitation to identify protein-protein interactions

  • Blue native PAGE to analyze intact membrane protein complexes

  • Cross-linking studies to capture transient protein interactions

  • Enzymatic activity assays to assess functional integration within the fumarate reductase complex

These techniques provide complementary information about expression levels, membrane integration, and functional assembly of FrdD within the fumarate reductase complex.

How does the structure-function relationship of FrdD contribute to fumarate reductase activity?

The structure-function relationship of FrdD is central to the proper assembly and activity of the fumarate reductase complex:

Structural Characteristics:
FrdD, as a membrane anchor protein, contains hydrophobic transmembrane helices that integrate into the cytoplasmic membrane. The specific arrangement of these helices creates a scaffold that:

  • Positions the catalytic subunits (FrdA and FrdB) in the optimal orientation relative to the membrane

  • Facilitates interaction with electron donors in the respiratory chain

  • Potentially contributes to proton translocation across the membrane

Functional Implications:
The proper integration of FrdD affects several aspects of fumarate reductase function:

  • Electron Transfer Efficiency:

    • Optimal positioning of iron-sulfur clusters in FrdB relative to the membrane

    • Proper alignment with other respiratory components like glycerol-3-phosphate dehydrogenase

  • Catalytic Activity:

    • Stabilization of the catalytic FrdA subunit in the correct conformation

    • Facilitation of substrate access to the active site

  • Energy Conservation:

    • Contribution to the coupling of fumarate reduction with proton translocation

    • Influence on the generation of proton motive force

Mutations or structural alterations in FrdD can disrupt these functions, potentially leading to reduced enzymatic activity and attenuated bacterial virulence.

What is the relationship between fumarate reductase activity and A. pleuropneumoniae pathogenesis?

The relationship between fumarate reductase activity and A. pleuropneumoniae pathogenesis has been experimentally established through several lines of evidence:

In Vivo Attenuation:
Deletion mutants lacking functional fumarate reductase (Δfrd) showed significant attenuation in a pig aerosol infection model:

  • Reduced clinical scores

  • Decreased reisolation scores

  • Statistically significant reduction in lung lesion scores (p ≤ 0.05)

  • Qualitative differences in lung pathology (mild bronchiolo-interstitial pneumonia in Δfrd-infected animals versus severe fibrinous pleuropneumonia in wild-type infections)

ParameterWild-type A. pleuropneumoniaeΔfrd MutantStatistical Significance
Lung Lesion ScoreSevereSignificantly Reducedp ≤ 0.05
Clinical ScoreHighReducedNot significant
Reisolation ScoreHighReducedNot significant
Pathology TypeSevere fibrinous pleuropneumoniaMild bronchiolo-interstitial pneumoniaQualitative difference

Metabolic Adaptation:
Fumarate reductase enables A. pleuropneumoniae to:

  • Generate energy via anaerobic respiration in oxygen-limited environments

  • Produce essential metabolic intermediates via the reductive branch of the citric acid cycle

  • Utilize glycerol-3-phosphate as a reduction equivalent, potentially derived from host phospholipids

Persistence Mechanism:
The ability to use fumarate as a terminal electron acceptor provides A. pleuropneumoniae with a metabolic advantage in the respiratory tract, allowing for:

  • Colonization of mucous membranes with limited oxygen availability

  • Persistence in the porcine respiratory tract during infection

  • Adaptation to changing oxygen levels during disease progression

These findings collectively establish fumarate reductase as a critical virulence factor in A. pleuropneumoniae infections.

How does the regulation of fumarate reductase interact with other virulence mechanisms in A. pleuropneumoniae?

The regulation of fumarate reductase in A. pleuropneumoniae is integrated with other virulence mechanisms through complex regulatory networks:

Coordination with Metabolic Pathways:

  • The ArcA regulatory system coordinates fumarate reductase activity with broader metabolic adaptations:

    • Downregulation of competing metabolic pathways (pyruvate dehydrogenase, malate:quinone reductase)

    • Upregulation of complementary pathways (glycerol-3-phosphate dehydrogenase)

    • Redirection of metabolic flux toward fumarate synthesis and reduction

  • Integration with carbon source utilization:

    • Optimization of glycerol-3-phosphate utilization from host phospholipids

    • Adaptation to available nutrients in the host environment

Interaction with Oxygen-Responsive Systems:

  • Coordination with other anaerobic respiration systems

  • Cross-regulation with oxidative stress responses

  • Integration with biofilm formation mechanisms, which create oxygen gradients

Potential Interaction with Epigenetic Regulation:
Recent research has identified phase-variable DNA methyltransferases in A. pleuropneumoniae that create phasevarions (phase-variable regulons). These systems can potentially influence the expression of multiple genes, including virulence factors, through epigenetic mechanisms .

While direct evidence for epigenetic regulation of fumarate reductase isn't established in the available research, these newly described regulatory mechanisms may represent an additional layer of control over metabolic adaptation and virulence.

The integration of fumarate reductase regulation with these diverse control systems allows A. pleuropneumoniae to fine-tune its virulence mechanisms in response to changing host environments, potentially contributing to its success as a respiratory pathogen.

How might fumarate reductase inhibitors be developed as potential therapeutics against A. pleuropneumoniae infections?

The development of fumarate reductase inhibitors as therapeutics against A. pleuropneumoniae follows several strategic approaches:

Target Identification and Validation:
Research has established fumarate reductase as a valid therapeutic target based on:

  • Deletion mutants showing significant attenuation in vivo

  • The enzyme's crucial role in bacterial persistence and virulence

  • The absence of homologous enzymes in higher eukaryotes, reducing potential toxicity

Compound Discovery and Development:
Several approaches can be pursued:

  • Adaptation of existing inhibitors:

    • Nafuredin, a novel anthelminthic substance that inhibits fumarate reductase, has shown success in treating experimental Haemonchus contortus infections in sheep

    • Other known inhibitors of bacterial fumarate reductases could be optimized for A. pleuropneumoniae

  • Rational drug design strategies:

    • Structure-based design targeting unique features of the A. pleuropneumoniae fumarate reductase

    • Fragment-based screening to identify novel chemical scaffolds

    • Virtual screening of compound libraries against modeled enzyme structures

  • High-throughput screening approaches:

    • Enzymatic assays measuring NADH consumption in the presence of fumarate

    • Whole-cell screening for compounds that specifically attenuate anaerobic growth

    • Phenotypic screens focusing on biofilm disruption or reduced persistence

Implementation Considerations:

  • Delivery systems tailored to respiratory infections

  • Combination with existing antibiotics to enhance efficacy

  • Strategies to minimize resistance development

These approaches could lead to novel therapeutics targeting an essential metabolic process in A. pleuropneumoniae, potentially addressing the economic impact of porcine pleuropneumonia in the swine industry.

What experimental models are most suitable for studying recombinant FrdD function and interactions?

Several experimental models can be employed to study recombinant FrdD function and interactions:

In Vitro Biochemical Systems:

  • Reconstituted membrane systems:

    • Proteoliposomes containing purified recombinant fumarate reductase complex

    • Nanodiscs for studying membrane protein function in a controlled lipid environment

    • Artificial membrane systems for measuring proton translocation

  • Enzyme activity assays:

    • Spectrophotometric measurement of NADH oxidation in the presence of fumarate

    • Oxygen consumption assays to monitor respiratory activity

    • Radiolabeled substrate tracking for detailed kinetic analysis

Cellular Models:

  • Heterologous expression systems:

    • E. coli expression systems for protein production and functional studies

    • Complementation of E. coli fumarate reductase mutants

  • A. pleuropneumoniae genetic models:

    • Δfrd mutants complemented with modified frdD variants

    • Fluorescent protein fusions for localization studies

    • Controlled expression systems for dose-dependent analysis

Advanced Structural Biology Approaches:

  • Cryo-electron microscopy for structural determination of the intact complex

  • Cross-linking mass spectrometry to map protein-protein interactions

  • Hydrogen-deuterium exchange mass spectrometry to study protein dynamics

  • Nuclear magnetic resonance for studying specific interactions

In Vivo Infection Models:

  • Pig aerosol infection model:

    • Allows evaluation of mutations in a natural host

    • Enables assessment of lung pathology and bacterial persistence

    • Provides clinically relevant endpoints (lung lesion scores, clinical scores)

  • Cell culture infection models:

    • Primary porcine respiratory epithelial cells

    • Differentiated airway cell culture systems

    • Co-culture systems incorporating immune cells

These complementary experimental models provide a comprehensive toolkit for dissecting FrdD function from the molecular to the organismal level.

How might insights from studying A. pleuropneumoniae fumarate reductase inform research on other respiratory pathogens?

Insights from A. pleuropneumoniae fumarate reductase research have broad implications for understanding other respiratory pathogens:

Cross-Species Mechanistic Understanding:
The fundamental role of fumarate reductase in A. pleuropneumoniae pathogenesis suggests similar mechanisms may operate in other bacterial pathogens that colonize mucosal surfaces in respiratory and gastrointestinal tracts. Specific insights include:

  • Metabolic adaptation strategies for survival in oxygen-limited environments

  • Energy production mechanisms during host colonization

  • Generation of essential metabolic intermediates under anaerobic conditions

Therapeutic Development Platforms:
Research on A. pleuropneumoniae fumarate reductase provides a model for therapeutic development that could be extended to other pathogens:

  • Repurposing potential fumarate reductase inhibitors like nafuredin for other bacterial infections

  • Developing broad-spectrum therapeutics targeting conserved aspects of bacterial metabolism

  • Establishing screening platforms for identifying novel antimicrobial compounds

Comparative Genomics and Evolution:
Understanding the fumarate reductase system in A. pleuropneumoniae enables comparative studies across species:

  • Analysis of conservation and divergence in respiratory chain components

  • Investigation of regulatory mechanisms controlling metabolic adaptation

  • Identification of species-specific features that could be exploited for targeted interventions

Integrated Pathogenesis Models:
The connection between fumarate reductase and virulence in A. pleuropneumoniae contributes to more comprehensive models of bacterial pathogenesis:

  • Integration of metabolic adaptation with traditional virulence factors

  • Understanding the relationship between bacterial metabolism and host immune responses

  • Development of new paradigms for persistent infections in respiratory tissues

This cross-disciplinary translation of knowledge from A. pleuropneumoniae research to other bacterial pathogens could accelerate progress in addressing a range of clinically and economically important infections.

What are the main challenges in expressing and purifying functional recombinant FrdD protein?

Expressing and purifying functional recombinant FrdD protein presents several technical challenges with corresponding solutions:

Challenge 1: Membrane Protein Expression
FrdD, as a membrane anchor protein, contains hydrophobic domains that can cause:

  • Protein misfolding

  • Formation of inclusion bodies

  • Toxicity to expression hosts

  • Low expression yields

Solutions:

  • Specialized expression strains:

    • C41(DE3) and C43(DE3) E. coli strains designed for membrane protein expression

    • Tunable expression systems with tight regulation of expression levels

  • Fusion partners to enhance solubility:

    • Maltose-binding protein (MBP)

    • Small ubiquitin-like modifier (SUMO)

    • Thioredoxin fusions

  • Expression conditions optimization:

    • Reduced temperature (16-20°C)

    • Lower inducer concentrations

    • Extended expression times

Challenge 2: Maintaining Functional Structure
FrdD functions as part of a multi-subunit complex, making isolation while preserving function difficult.

Solutions:

  • Co-expression strategies:

    • Simultaneous expression of multiple fumarate reductase subunits

    • Co-expression with chaperone proteins

  • Membrane-mimetic environments:

    • Detergent selection based on protein stability and activity

    • Lipid nanodisc incorporation

    • Amphipol stabilization

  • Complex isolation approaches:

    • Tandem affinity purification

    • Mild solubilization conditions

    • Native complex isolation

Challenge 3: Functional Validation
Confirming that purified FrdD retains native structure and function is challenging.

Solutions:

  • Activity assays:

    • Reconstitution with other subunits

    • Monitoring complex assembly

    • Measuring electron transfer capacity

  • Structural integrity assessment:

    • Circular dichroism spectroscopy

    • Limited proteolysis patterns

    • Thermal stability assays

These technical solutions enable researchers to overcome the inherent challenges of working with membrane proteins like FrdD.

How can researchers effectively study the interaction between FrdD and other fumarate reductase subunits?

Researchers can employ several complementary approaches to study interactions between FrdD and other fumarate reductase subunits:

Genetic Approaches:

  • Bacterial two-hybrid systems adapted for membrane proteins:

    • BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system

    • Split-ubiquitin yeast two-hybrid variants

  • Suppressor mutation analysis:

    • Identifying compensatory mutations that restore function

    • Mapping interaction interfaces through genetic analysis

  • Chimeric protein construction:

    • Domain swapping between homologous proteins

    • Fusion of interaction domains to reporter proteins

Biochemical Methods:

  • Co-purification strategies:

    • Tandem affinity purification using tags on different subunits

    • Chemical cross-linking followed by mass spectrometry (XL-MS)

    • Pull-down assays with recombinant components

  • Surface plasmon resonance (SPR):

    • Measuring binding kinetics between purified components

    • Determining affinity constants for subunit interactions

  • Isothermal titration calorimetry (ITC):

    • Quantifying thermodynamic parameters of binding

    • Stoichiometry determination

Structural Biology Techniques:

  • Cryo-electron microscopy:

    • Structure determination of intact complexes

    • Visualization of subunit arrangements

  • NMR spectroscopy for specific interactions:

    • Chemical shift perturbation analysis

    • Residue-specific interaction mapping

  • Hydrogen-deuterium exchange mass spectrometry:

    • Identifying protected regions upon complex formation

    • Mapping conformational changes during assembly

Computational Approaches:

  • Molecular dynamics simulations:

    • Modeling subunit interactions in membrane environments

    • Predicting effects of mutations on complex stability

  • Protein-protein docking:

    • In silico prediction of binding interfaces

    • Virtual screening of interaction-disrupting compounds

By combining these diverse approaches, researchers can develop a comprehensive understanding of how FrdD interacts with other fumarate reductase subunits to form a functional complex.

What strategies can overcome the challenges of studying membrane-associated proteins like FrdD in A. pleuropneumoniae?

Studying membrane-associated proteins like FrdD in A. pleuropneumoniae requires specialized strategies to address unique challenges:

Challenge 1: Native Environment Preservation
Removing membrane proteins from their lipid environment often disrupts structure and function.

Solutions:

  • Native membrane isolation techniques:

    • Gentle cell disruption methods

    • Gradient centrifugation for membrane fraction isolation

    • Selective membrane solubilization

  • Membrane-mimetic systems:

    • Nanodiscs with defined lipid composition

    • Styrene-maleic acid lipid particles (SMALPs)

    • Digitonin or other mild detergents for complex isolation

Challenge 2: In Situ Analysis
Studying membrane proteins within their native cellular context is technically demanding.

Solutions:

  • Advanced microscopy techniques:

    • Super-resolution microscopy (STORM, PALM)

    • Correlative light and electron microscopy

    • Single-molecule tracking in live bacteria

  • Proximity labeling approaches:

    • BioID or TurboID fusions for protein interaction mapping

    • Proximity-dependent biotin identification

    • APEX2-based proximity labeling

Challenge 3: Functional Analysis in Native Context
Assessing function while maintaining physiological relevance is challenging.

Solutions:

  • Genetic reporter systems:

    • Transcriptional reporters for activity

    • Split fluorescent protein complementation

    • Conditional depletion systems

  • Whole-cell physiological assays:

    • Membrane potential measurements

    • Respiratory activity monitoring

    • Growth under defined conditions

Challenge 4: Species-Specific Considerations
A. pleuropneumoniae presents additional challenges as a fastidious organism.

Solutions:

  • Heterologous expression systems:

    • Expression in related Pasteurellaceae family members

    • Adaptation of genetic tools from other bacterial systems

    • Development of A. pleuropneumoniae-specific expression vectors

  • Comparative analysis:

    • Leveraging knowledge from better-studied homologs

    • Cross-species complementation studies

    • Chimeric protein approaches

By implementing these specialized strategies, researchers can overcome the inherent challenges of studying membrane proteins like FrdD while maintaining functional and structural integrity.

What are the key unresolved questions about A. pleuropneumoniae fumarate reductase that require further research?

Despite significant advances in understanding A. pleuropneumoniae fumarate reductase, several key questions remain unresolved:

Structural Aspects:

  • What is the high-resolution structure of the A. pleuropneumoniae fumarate reductase complex?

  • How does the membrane organization of FrdD contribute to proton translocation and energy conservation?

  • What are the specific interaction interfaces between FrdD and other subunits?

Regulatory Mechanisms:

  • How is fumarate reductase expression fine-tuned during different stages of infection?

  • What role might the newly discovered phase-variable DNA methyltransferases play in regulating fumarate reductase expression?

  • How does the ArcA regulatory system integrate with other virulence-associated regulators?

Host-Pathogen Interactions:

  • How does host immune response affect fumarate reductase expression and activity?

  • What host-derived substrates specifically feed into the fumarate reductase pathway during infection?

  • How does the spatial distribution of fumarate reductase activity within bacterial populations affect tissue colonization?

Therapeutic Development:

  • Can structure-based design yield specific inhibitors of A. pleuropneumoniae fumarate reductase?

  • What is the potential for resistance development against fumarate reductase inhibitors?

  • How might fumarate reductase inhibition be combined with other therapeutic approaches for synergistic effects?

Addressing these questions will require interdisciplinary approaches combining structural biology, molecular genetics, biochemistry, and infection biology.

How might advances in structural biology and protein engineering impact future research on recombinant FrdD?

Advances in structural biology and protein engineering offer transformative potential for FrdD research:

Emerging Structural Biology Technologies:

  • Cryo-electron microscopy advancements:

    • Direct visualization of membrane protein complexes in native-like environments

    • Time-resolved structures capturing dynamic states

    • In situ structural determination within bacterial cells

  • Integrative structural biology approaches:

    • Combining cryo-EM, X-ray crystallography, and NMR data

    • Computational modeling informed by multiple experimental inputs

    • Mass spectrometry-based structural proteomics

Protein Engineering Applications:

  • Designer FrdD variants:

    • Stabilized proteins for structural studies

    • Altered substrate specificity for metabolic engineering

    • Tagged versions for in vivo tracking

  • Synthetic biology approaches:

    • Minimal fumarate reductase complexes with defined components

    • Chimeric complexes with parts from different species

    • Engineered regulatory circuits controlling expression

Potential Impact Areas:

  • Fundamental understanding:

    • Mechanism of electron transfer through the complex

    • Role of specific residues in membrane anchoring

    • Conformational changes during catalysis

  • Biotechnological applications:

    • Engineered strains with altered respiratory capabilities

    • Biosensors based on fumarate reductase activity

    • Biocatalysts for specific chemical transformations

  • Therapeutic development:

    • Structure-based inhibitor design

    • Identification of allosteric regulatory sites

    • Development of biologics targeting complex assembly

These advances will enable researchers to move beyond traditional limitations in membrane protein research, potentially accelerating discovery in both basic science and applied biotechnology.

What potential exists for cross-disciplinary applications of knowledge gained from studying A. pleuropneumoniae fumarate reductase?

Knowledge gained from studying A. pleuropneumoniae fumarate reductase has significant potential for cross-disciplinary applications:

Veterinary Medicine and Agricultural Science:

  • Development of novel therapeutics for porcine respiratory diseases

  • Creation of improved vaccines targeting metabolic antigens

  • Diagnostic tools based on fumarate reductase activity or antibodies

Comparative Microbiology and Evolutionary Biology:

  • Understanding the evolution of respiratory systems across bacterial species

  • Insights into adaptation mechanisms for host-specific colonization

  • Comparative genomics of metabolic adaptation in diverse pathogens

Biotechnology and Synthetic Biology:

  • Engineering bacterial strains with enhanced anaerobic respiration for bioproduction

  • Development of biocatalysts for specific chemical transformations

  • Creation of biosensors based on respiratory activity for environmental monitoring

Human Medicine and One Health Initiatives:

  • Parallel therapeutic strategies for human respiratory pathogens

  • Understanding metabolic adaptation in polymicrobial infections

  • Development of broad-spectrum approaches targeting conserved respiratory components

Systems Biology and Computational Modeling:

  • Integration of fumarate reductase into whole-cell metabolic models

  • Prediction of metabolic adaptation under varying environmental conditions

  • Simulation of bacterial population dynamics during infection

This cross-disciplinary potential highlights how fundamental research on bacterial metabolism can extend far beyond its initial focus, contributing to diverse fields and applications with significant societal impact.

What genetic tools and resources are available for studying fumarate reductase in A. pleuropneumoniae?

Researchers investigating fumarate reductase in A. pleuropneumoniae have access to several genetic tools and resources:

Genetic Modification Systems:

  • Conjugation-based methods:

    • Protocols using E. coli β2155 donor strains

    • pEMOC2-based suicide vectors for gene replacement

    • Natural transformation systems for some strains

  • Deletion strategy tools:

    • In-frame deletion protocols for precise gene removal

    • Counter-selection markers for seamless mutations

    • Complementation vectors for functional validation

Genome Resources:

  • Complete genome sequences for multiple A. pleuropneumoniae serotypes

  • Annotated gene sequences for fumarate reductase subunits

  • Comparative genomic databases for Pasteurellaceae family members

Expression Systems:

  • Inducible promoters for controlled gene expression

  • Shuttle vectors functional in both E. coli and A. pleuropneumoniae

  • Reporter gene fusions for expression analysis

Verification Methods:

  • Southern blotting protocols for confirming genetic modifications

  • PCR-based verification strategies

  • Whole genome sequencing for confirming genetic integrity

  • Pulsed-field gel electrophoresis for detecting genomic rearrangements

Functional Assay Systems:

  • Enzymatic assays for fumarate reductase activity:

    • Spectrophotometric measurement of NADH consumption

    • Protocols for preparing whole-cell lysates

    • Complementation assays for functional validation

These tools enable researchers to conduct sophisticated genetic manipulation and functional analysis of fumarate reductase in A. pleuropneumoniae.

How can transcriptomic and proteomic approaches be applied to study the impact of FrdD on global gene expression?

Transcriptomic and proteomic approaches offer powerful methods to investigate the global impact of FrdD:

Transcriptomic Strategies:

  • RNA-Seq analysis:

    • Comparison of wild-type and frdD mutant strains

    • Analysis under different oxygen conditions

    • Time-course studies during infection

  • Microarray applications:

    • Whole-genome expression profiling

    • Custom arrays focusing on metabolic pathways

    • Analysis of regulatory networks

  • Quantitative RT-PCR:

    • Validation of key expression changes

    • Time-resolved expression analysis

    • Strain-to-strain comparisons

Proteomic Methods:

  • Two-dimensional difference gel electrophoresis (2D DIGE):

    • Comparison of protein expression profiles

    • Identification of differentially expressed proteins

    • Quantitative analysis of protein abundance changes

  • Mass spectrometry-based proteomics:

    • Label-free quantitative proteomics

    • Stable isotope labeling approaches (SILAC)

    • Targeted proteomics for specific pathway components

  • Protein interaction mapping:

    • Immunoprecipitation coupled with mass spectrometry

    • Proximity-dependent biotin identification

    • Bacterial two-hybrid screening

Integrated Multi-Omics Approaches:

  • Combined transcriptome-proteome analysis:

    • Correlation of transcript and protein changes

    • Identification of post-transcriptional regulation

    • Comprehensive pathway analysis

  • Integration with metabolomics:

    • Linking expression changes to metabolite levels

    • Flux analysis of key metabolic pathways

    • Comprehensive metabolic modeling

ApproachKey ApplicationsAdvantagesChallenges
RNA-SeqGlobal transcriptome analysisComprehensive, sensitive, quantitativeRNA stability, technical complexity
2D DIGEProtein expression profilingVisual comparison, quantitativeLimited to abundant proteins
Mass SpectrometryDeep proteome analysisHigh throughput, sensitiveSample preparation complexity
Integrated AnalysisSystems-level understandingComprehensive pathway insightsComputational complexity

These approaches can reveal how FrdD impacts global gene expression beyond its immediate role in the fumarate reductase complex, potentially identifying unexpected regulatory connections and metabolic adaptations.

What in vivo models provide the most relevant insights for FrdD research in the context of A. pleuropneumoniae pathogenesis?

Several in vivo models provide relevant insights for FrdD research in A. pleuropneumoniae pathogenesis:

Pig Aerosol Infection Model:
This natural host model offers the most physiologically relevant system for studying FrdD function in pathogenesis:

  • Key advantages:

    • Reflects natural route of infection

    • Enables assessment of all stages of disease progression

    • Allows evaluation of complex host-pathogen interactions

    • Provides clinically relevant endpoints (lung lesion scores, clinical symptoms)

  • Specific measurements:

    • Lung lesion scores and pathology

    • Clinical scores tracking disease progression

    • Bacterial reisolation rates from tissues

    • Histopathological analysis of infected tissues

  • Documented findings:

    • Fumarate reductase deletion mutants show significantly reduced lung lesion scores

    • Qualitative differences in pathology (mild bronchiolo-interstitial pneumonia versus severe fibrinous pleuropneumonia)

    • Persistence differences between wild-type and mutant strains

Alternative Models:
While less representative of natural infection, these models offer advantages for specific research questions:

  • Porcine precision-cut lung slices:

    • Maintains lung architecture and cell composition

    • Enables controlled experimental conditions

    • Reduces animal usage

    • Allows for imaging of bacterial-tissue interactions

  • Primary porcine respiratory epithelial cells:

    • Permits study of bacterial adherence and early infection events

    • Enables analysis of host cell responses

    • Allows manipulation of specific factors

    • Facilitates high-throughput screening approaches

  • Porcine alveolar macrophage models:

    • Important for studying phagocytosis and immune evasion

    • Relevant for investigating persistence mechanisms

    • Enables analysis of respiratory burst responses

    • Allows for manipulation of oxygen availability

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.