Recombinant Actinobacillus pleuropneumoniae serotype 5b Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Actinobacillus pleuropneumoniae Serotype 5b Glycerol-3-Phosphate Acyltransferase (PlsY) is a genetically engineered enzyme critical for lipid biosynthesis in the bacterial pathogen A. pleuropneumoniae. This enzyme catalyzes the first step of phospholipid formation by transferring an acyl group from acyl-phosphate to the sn-1 position of glycerol-3-phosphate (G3P), producing lysophosphatidic acid (LPA) . PlsY is essential for membrane biogenesis and bacterial survival under anaerobic conditions, which are common during infection in swine respiratory tracts .

3.1. Role in Bacterial Pathogenesis

PlsY is implicated in A. pleuropneumoniae virulence due to its role in anaerobic metabolism. During infection, the bacterium upregulates anaerobic metabolic enzymes like PlsY to adapt to low-oxygen environments in porcine lungs . Deletion of anaerobic respiratory genes (e.g., dmsA, aspA) attenuates virulence, highlighting the importance of lipid synthesis for survival in host tissues .

3.2. Recombinant Protein Utility

  • Vaccine Development: Recombinant PlsY could serve as a target for subunit vaccines, given its surface exposure and role in pathogenesis .

  • Enzymatic Studies: Used to characterize GPAT kinetics and substrate specificity, revealing a preference for oleic acid over palmitic acid in lipid synthesis .

  • Antimicrobial Research: Inhibitors targeting PlsY could disrupt membrane biogenesis, offering therapeutic potential .

Comparative Genomic Insights

PlsY homologs are conserved across A. pleuropneumoniae serotypes. For example:

  • Serotype 5b: Encodes PlsY (A3N1Y9) with 100% sequence identity to recombinant constructs .

  • Serotype 3: Shares 98% amino acid similarity, indicating functional conservation .

Phase-variable DNA methyltransferases in A. pleuropneumoniae regulate gene expression epigenetically, potentially affecting PlsY production under stress .

Technical Challenges and Innovations

  • Expression Optimization: High-yield recombinant PlsY production in E. coli requires codon optimization and induction at low temperatures .

  • Structural Analysis: Cryo-EM or X-ray crystallography is needed to resolve PlsY’s active site, leveraging insights from homologous enzymes like ApxC .

Future Directions

  • Vaccine Trials: Evaluate immunogenicity of recombinant PlsY in swine models .

  • Mechanistic Studies: Elucidate how PlsY interacts with acyl-phosphates and integrates with anaerobic respiratory pathways[4

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; APL_1341; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-196
Protein Length
full length protein
Species
Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Target Names
plsY
Target Protein Sequence
MSITVYLLIVFAYLLGSVSSAIIFCRLAGLPDPRENGSHNPGATNVLRIGGKFSALGVLL FDILKGGLPVLLAFNFKLEPSEIGLIALAACLGHIFPLFFRFRGGKGVATAFGALLSISF AASAAGLCTWLIVFLLFGYSSLSAVITALIMPFYIWWFLPEFTFPVALVCCLLVYRHHDN IQRLWRGQEQPMWARK
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of Glycerol-3-phosphate acyltransferase (plsY) in A. pleuropneumoniae pathogenesis?

While specific research on plsY in A. pleuropneumoniae is emerging, this enzyme plays a fundamental role in phospholipid biosynthesis by catalyzing the transfer of an acyl group to glycerol-3-phosphate. In bacterial pathogens, phospholipid biosynthesis is critical for membrane integrity and function. Similar to other virulence factors in A. pleuropneumoniae (like ApxI, ApxII, and ApxIII toxins), plsY likely contributes to the pathogen's ability to establish infection. Research methods to study this would include generating knockout mutants and conducting comparative virulence studies in animal models similar to those developed for ApfA virulence studies .

How do recombinant expression systems for A. pleuropneumoniae proteins typically function?

Recombinant expression of A. pleuropneumoniae proteins typically involves identifying the gene of interest (such as plsY), PCR amplification, and cloning into an appropriate expression vector. Similar to the approach used for ApfA protein expression, the target gene can be expressed in systems like E. coli with subsequent purification via affinity chromatography . For optimal expression, codon optimization may be necessary based on the expression host. Validation of proper folding and function is essential, particularly for enzymes like plsY where activity assays would assess the transfer of acyl groups to glycerol-3-phosphate substrates.

What purification techniques are most effective for isolating recombinant A. pleuropneumoniae proteins?

The purification of recombinant A. pleuropneumoniae proteins typically employs a multi-step approach:

  • Affinity chromatography (histidine tag-based purification is common)

  • Ion exchange chromatography for further purification

  • Size exclusion chromatography to achieve higher purity

This approach has been successful with other A. pleuropneumoniae recombinant proteins such as ApxI, ApxII, and ApxIII . For enzymes like plsY, maintaining the proper buffer conditions to preserve enzymatic activity during purification is critical. Typical yield for recombinant A. pleuropneumoniae proteins ranges from 2-5 mg/L of bacterial culture, with purity >95% as assessed by SDS-PAGE.

How can I design specific primers for amplifying the plsY gene from A. pleuropneumoniae serotype 5b?

Designing specific primers for plsY amplification requires careful consideration of several factors:

  • Sequence analysis: Obtain the complete genome sequence of A. pleuropneumoniae serotype 5b and locate the plsY gene

  • Primer design parameters:

    • Primer length: 18-25 nucleotides

    • GC content: 40-60%

    • Melting temperature: 55-65°C with no more than 5°C difference between pairs

    • Avoid secondary structures and complementarity

Similar to the approach used for the TaqMan real-time PCR assay development for A. pleuropneumoniae , incorporating appropriate restriction sites for subsequent cloning is essential. Testing primer specificity through in silico analysis against other A. pleuropneumoniae genes and experimental validation with gradient PCR optimizes amplification conditions.

What expression vector systems are optimal for functional recombinant plsY production?

The selection of an expression vector system for recombinant plsY production should consider:

Expression SystemAdvantagesLimitationsRecommended Application
pET series (E. coli)High expression, tight regulationPotential inclusion body formationInitial protein characterization
pGEX (GST fusion)Enhanced solubilityLarger fusion tagProtein interaction studies
pMAL (MBP fusion)Improved solubility, activityLarger fusion proteinEnzymatic assays
pBAD (Arabinose-inducible)Tunable expressionLower yieldsToxic protein expression

When working with membrane-associated enzymes like plsY, vector systems that enhance protein solubility or enable controlled expression are particularly beneficial. The pMAL system with an MBP fusion tag has shown success with other A. pleuropneumoniae proteins by improving solubility while maintaining enzymatic activity .

How can I assess the enzymatic activity of purified recombinant plsY?

Assessing the enzymatic activity of purified recombinant plsY requires:

  • Substrate preparation: Synthesize or purchase glycerol-3-phosphate and appropriate acyl-CoA donors

  • Reaction conditions:

    • Buffer: Typically 50 mM Tris-HCl (pH 7.5), 10 mM MgCl₂

    • Temperature: 37°C (standard for A. pleuropneumoniae proteins)

    • Time course: 0-60 minutes to establish linearity

  • Activity measurement methods:

    • Spectrophotometric assays monitoring CoA release

    • Radiometric assays using labeled substrates

    • LC-MS/MS detection of product formation

The specific activity of the enzyme should be reported in μmol product formed per minute per mg protein. Validation should include controls for background activity and verification that the observed activity follows Michaelis-Menten kinetics.

How can I investigate the role of plsY in A. pleuropneumoniae biofilm formation?

Investigating plsY's role in biofilm formation requires a multi-faceted approach:

  • Generate a plsY deletion mutant using allelic exchange techniques

  • Compare biofilm formation between wild-type and mutant strains using:

    • Crystal violet staining for quantification

    • Confocal microscopy for structural analysis

    • Flow cell systems for real-time observation

Similar to approaches used to study S. suis and A. pleuropneumoniae mixed biofilms , the TaqMan real-time PCR assay could be adapted to quantify bacterial numbers within biofilms. Analysis should include measurement of biofilm thickness, density, and extracellular matrix composition. For complementation studies, expressing plsY under its native promoter would confirm phenotypic changes are specifically due to plsY disruption.

What are the challenges in developing plsY as a potential vaccine candidate compared to established A. pleuropneumoniae antigens?

Developing plsY as a vaccine candidate faces several challenges compared to established antigens:

  • Expression and purification: As a membrane-associated enzyme, maintaining proper folding and function may be difficult compared to secreted proteins like ApxI, II, and III

  • Immunogenicity assessment:

    • ELISA methods similar to those developed for Apx toxins would need modification for plsY-specific antibody detection

    • Western blot analysis to confirm antigenicity

    • T-cell response evaluation through cytokine profiling

  • Cross-protection potential:

    • Sequence conservation across serotypes needs thorough analysis

    • Challenge studies in animal models with multiple serotypes similar to ApfA vaccination studies

The development of subunit vaccines against A. pleuropneumoniae has shown good efficacy in terms of safety and protection , but enzyme antigens present unique challenges compared to toxins or adhesins.

How can structural analysis of plsY inform drug discovery efforts against A. pleuropneumoniae?

Structural analysis of plsY can significantly advance drug discovery through:

  • Protein structure determination:

    • X-ray crystallography of purified recombinant plsY

    • Cryo-EM analysis if crystallization proves challenging

    • In silico homology modeling based on related bacterial acyltransferases

  • Structure-based drug design:

    • Identify the catalytic site through substrate docking

    • Virtual screening of compound libraries against the active site

    • Fragment-based approaches to identify initial chemical scaffolds

  • Validation of potential inhibitors:

    • Enzymatic assays to determine IC₅₀ values

    • Bacterial growth inhibition studies

    • Assessment of resistance development potential

Since plsY catalyzes a critical step in phospholipid biosynthesis, inhibitors could potentially disrupt membrane integrity in A. pleuropneumoniae, providing a novel antimicrobial approach compared to targeting virulence factors like Apx toxins .

What strategies can overcome solubility issues with recombinant plsY expression?

Addressing solubility challenges with recombinant plsY expression requires systematic optimization:

  • Expression conditions modification:

    • Lower induction temperature (16-25°C)

    • Reduced inducer concentration

    • Extended expression time (overnight)

  • Fusion partners evaluation:

    • MBP tag (particularly effective for membrane proteins)

    • SUMO tag for enhanced solubility

    • Thioredoxin fusion systems

  • Co-expression with chaperones:

    • GroEL/ES system

    • DnaK/DnaJ/GrpE complex

    • Trigger factor

For membrane-associated proteins like plsY, addition of detergents (0.1-1% Triton X-100 or n-dodecyl β-D-maltoside) during lysis and purification can significantly improve solubility while maintaining enzymatic function. This approach differs from soluble proteins like ApxI, II, and III, which typically don't require such modifications .

How can I validate the specificity of anti-plsY antibodies for immunological studies?

Validating anti-plsY antibodies requires comprehensive characterization:

  • Western blot analysis:

    • Against purified recombinant plsY

    • A. pleuropneumoniae whole-cell lysates

    • Comparative analysis with other bacterial species

  • ELISA-based validation:

    • Titration curves to determine optimal antibody concentration

    • Competitive ELISA to confirm specificity

    • Cross-reactivity assessment with related proteins

  • Immunoprecipitation studies:

    • Pull-down of native plsY from bacterial lysates

    • Mass spectrometry confirmation of precipitated proteins

To overcome antibody cross-reactivity issues similar to those encountered with Apx toxins , identification of unique epitopes specific to plsY would be beneficial. Monoclonal antibodies targeting these regions would provide higher specificity than polyclonal preparations.

How should qPCR data for plsY expression be normalized when studying A. pleuropneumoniae under different growth conditions?

Proper normalization of qPCR data for plsY expression requires:

  • Reference gene selection:

    • Multiple candidates should be tested (16S rRNA, recA, gyrB)

    • Stability analysis across experimental conditions using tools like geNorm or NormFinder

    • At least 3 reference genes should be employed for robust normalization

  • Quantification method selection:

    • ΔΔCt method with validated primer efficiencies

    • Standard curve method for absolute quantification

  • Data presentation:

    • Relative fold change compared to control conditions

    • Statistical analysis to determine significance (ANOVA with post-hoc tests)

Similar to the TaqMan real-time PCR assay developed for A. pleuropneumoniae , establish a standard curve with recombinant plasmids containing plsY to ensure accurate quantification. Amplification efficiency should ideally be between 90-110% with R² values >0.995 for reliable quantification.

What statistical approaches are appropriate for analyzing plsY enzyme kinetics data?

Analysis of plsY enzyme kinetics requires appropriate statistical approaches:

  • Kinetic parameter determination:

    • Non-linear regression to fit Michaelis-Menten equation

    • Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf plots for visualization

    • Bootstrap analysis for confidence interval estimation

  • Inhibition studies analysis:

    • IC₅₀ determination through sigmoid curve fitting

    • Inhibition constant (Ki) calculation

    • Determination of inhibition mechanism (competitive, non-competitive, uncompetitive)

  • Comparative analysis:

    • ANOVA for comparing multiple conditions

    • Post-hoc tests (Tukey's, Dunnett's) for pairwise comparisons

    • Mixed-effects models for repeated measures designs

Report kinetic parameters (Km, Vmax, kcat, kcat/Km) with standard errors and confidence intervals. For inhibition studies, present dose-response curves with IC₅₀ values and Hill coefficients to fully characterize the inhibitory properties.

How can transmission experiments be designed to evaluate the impact of plsY inhibition on A. pleuropneumoniae infection dynamics?

Designing transmission experiments to evaluate plsY inhibition requires a methodical approach:

  • Experimental design similar to established transmission models :

    • Create subclinically infected carrier pigs through contact exposure

    • Observe transmission to susceptible contact pigs

    • Implement plsY inhibition intervention in treatment groups

  • Quantification methods:

    • TaqMan real-time PCR for bacterial load measurement

    • Serological monitoring using ELISA

    • Clinical scoring systems for disease severity

  • Statistical analysis using generalized linear models (GLM) :

    • Separate evaluation of effects on susceptibility and infectivity

    • Calculation of reproduction ratio (R) to quantify transmission

    • Time-to-event analysis for infection dynamics

This experimental approach allows for quantification of A. pleuropneumoniae transmission and testing of the effect of plsY inhibition on transmission . Include appropriate controls and sufficient replication (minimum 10 animals per group) to ensure statistical power.

What interdisciplinary approaches can enhance research on plsY as a therapeutic target?

Advancing plsY research as a therapeutic target benefits from interdisciplinary collaboration:

  • Structural biology and computational approaches:

    • Protein crystallography for structure determination

    • Molecular dynamics simulations to understand conformational changes

    • Virtual screening and docking studies for inhibitor discovery

  • Medicinal chemistry and pharmacology:

    • Structure-activity relationship studies of identified inhibitors

    • ADME (absorption, distribution, metabolism, excretion) profiling

    • In vivo pharmacokinetic and efficacy studies

  • Immunology and vaccine development:

    • Epitope mapping and immunogenic region identification

    • Adjuvant formulation optimization

    • Immune response characterization using methods similar to those developed for Apx toxins

Collaborative approaches combining these disciplines can accelerate the development of plsY-targeted therapeutics or vaccines. Coordination through regular interdisciplinary meetings and shared data platforms ensures integration of diverse expertise.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.