Recombinant Actinobacillus pleuropneumoniae serotype 5b Na(+)-translocating NADH-quinone reductase subunit E is a recombinant protein derived from the bacterium Actinobacillus pleuropneumoniae, specifically serotype 5b. This protein is part of the Na(+)-translocating NADH-quinone reductase (NQR) complex, which plays a crucial role in energy metabolism and ion homeostasis in bacteria.
The Na(+)-translocating NADH-quinone reductase complex is essential for the survival and pathogenesis of Actinobacillus pleuropneumoniae. It is involved in generating a sodium gradient across the cell membrane, which is crucial for energy transduction and maintaining cytoplasmic pH homeostasis . In marine and halophilic bacteria, this complex is well-studied for its role in energy metabolism and ion balance.
Species: Actinobacillus pleuropneumoniae serotype 5b (strain L20).
Protein Name: Na(+)-translocating NADH-quinone reductase subunit E.
Uniprot Number: A3MYM6.
Tag Info: The tag type is determined during production.
Storage Buffer: Tris-based buffer with 50% glycerol.
Storage Conditions: Store at -20°C for extended storage or conserve at -20°C or -80°C. Avoid repeated freezing and thawing.
The NQR complex, including subunit E, is crucial for the persistence of Actinobacillus pleuropneumoniae in its host. Studies using signature-tagged mutagenesis have shown that mutations in the nqrB gene, part of the NQR complex, significantly impair the bacterium's ability to survive in vivo .
Recombinant Na(+)-translocating NADH-quinone reductase subunit E is used in ELISA kits for detecting antibodies against Actinobacillus pleuropneumoniae serotype 5b. These kits are valuable tools for diagnosing infections and studying immune responses .
Understanding the role of Na(+)-translocating NADH-quinone reductase in pathogenesis could contribute to the development of more effective vaccines against Actinobacillus pleuropneumoniae. By targeting essential proteins like subunit E, researchers may develop novel vaccine candidates .
| Characteristic | Description |
|---|---|
| Species | Actinobacillus pleuropneumoniae serotype 5b (strain L20) |
| Protein Name | Na(+)-translocating NADH-quinone reductase subunit E |
| Uniprot Number | A3MYM6 |
| Storage Buffer | Tris-based buffer with 50% glycerol |
| Storage Conditions | Store at -20°C or -80°C |
| Sequence Portion | Amino Acid Sequence |
|---|---|
| Full Sequence | MEHYLSLFVKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGIAVIVVLGIAVPANQLVY THVLKDGALVEGVDLSFLNFITFIGVIAALVQILEMILDKFFPALYSALGIFLPLITVNC AIFGGVSFMVQREYNFTESVVYGLGAGTGWmLAIVALAGLTEKMKYSDVPAGLRGLGITF ITVGLMALGFMSFSGIQL |
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol via two sequential reactions coupled with Na+ ion transport from the cytoplasm to the periplasm. NqrA to NqrE proteins are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
KEGG: apl:APL_0154
STRING: 416269.APL_0154
Na(+)-translocating NADH-quinone reductase subunit E (NqrE) is a membrane protein component of the Na(+)-NQR complex in Actinobacillus pleuropneumoniae. This complex (EC 1.6.5.-) plays a crucial role in the bacterial respiratory chain by coupling NADH oxidation to sodium ion translocation across the membrane, thereby generating an electrochemical gradient used for energy production . In A. pleuropneumoniae serotype 5b (strain L20), this protein is encoded by the nqrE gene (locus APL_0154) and consists of 198 amino acids . The Na(+)-NQR complex is particularly important for energy metabolism in marine and halophilic bacteria, but also plays significant roles in pathogens like A. pleuropneumoniae that must adapt to challenging host environments .
The recombinant Na(+)-translocating NADH-quinone reductase subunit E should be stored in a Tris-based buffer with 50% glycerol at -20°C for routine storage, or at -80°C for extended storage periods . Working aliquots can be maintained at 4°C for up to one week to minimize protein degradation from repeated freeze-thaw cycles, which should be avoided as they can significantly reduce protein activity and integrity .
For experimental handling, consider the following protocol:
Thaw protein aliquots on ice slowly to maintain structural integrity
Maintain protein in buffer conditions that mimic its native environment (considering pH and salt concentration)
Avoid extended exposure to room temperature
Use freshly prepared aliquots for critical experiments
Include protease inhibitors when working with cell lysates or during purification
These precautions are essential because membrane proteins like NqrE are particularly susceptible to denaturation and aggregation when removed from their native lipid environment.
The expression of membrane proteins like Na(+)-translocating NADH-quinone reductase subunit E presents significant challenges due to their hydrophobic nature and requirement for correct membrane insertion. Based on current research methodologies for similar bacterial membrane proteins, the following expression systems have proven effective:
| Expression System | Advantages | Challenges | Yield |
|---|---|---|---|
| E. coli BL21(DE3) | Fast growth, easy handling, well-established protocols | Potential toxicity, inclusion body formation | Moderate |
| C41/C43 E. coli strains | Specifically designed for membrane proteins, reduced toxicity | More expensive, slower growth | High |
| Cell-free systems | Avoids toxicity issues, allows direct incorporation into nanodiscs or liposomes | Technical complexity, higher cost | Variable |
| Yeast systems (P. pastoris) | Better for complex membrane proteins, glycosylation capability | Longer development time, complex media requirements | Moderate-High |
For A. pleuropneumoniae membrane proteins specifically, the addition of specific chaperones and careful optimization of induction conditions (temperature, inducer concentration, and induction time) significantly improves the yield of properly folded protein . The incorporation of affinity tags (typically determined during the production process) facilitates purification while minimizing interference with protein function.
Incorporating recombinant Na(+)-translocating NADH-quinone reductase subunit E into functional assays requires careful consideration of its native membrane environment. Researchers should consider the following methodological approaches:
Reconstitution into liposomes:
Prepare lipid mixtures that mimic bacterial membranes (typically phosphatidylglycerol and cardiolipin)
Use detergent-mediated reconstitution followed by detergent removal via dialysis or bio-beads
Verify incorporation using freeze-fracture electron microscopy or fluorescence-based assays
Activity measurement:
Monitor NADH oxidation spectrophotometrically at 340 nm
Track Na+ translocation using fluorescent indicators like SBFI or radioactive Na+ isotopes
Measure quinone reduction using specific quinone analogs
Interaction studies:
Employ crosslinking approaches with other NQR complex subunits
Use surface plasmon resonance to quantify binding kinetics with putative partners
Apply microscale thermophoresis for detecting interactions in solution
The study of interactions between Na(+)-translocating NADH-quinone reductase subunit E and other respiratory chain components requires specialized techniques suitable for membrane protein complexes:
Blue Native PAGE:
Preserves native protein-protein interactions
Allows visualization of intact complexes
Can be combined with second-dimension SDS-PAGE for subunit identification
Cryo-Electron Microscopy:
Enables structural characterization of the entire NQR complex
Reveals interaction interfaces between subunits
Provides insights into conformational changes during catalysis
Co-immunoprecipitation with specific antibodies:
Can pull down intact complexes from solubilized membranes
Allows identification of transient interaction partners
Compatible with subsequent mass spectrometry analysis
FRET-based approaches:
Can be used to study dynamic interactions in real-time
Requires fluorescent labeling of purified components
Provides information about spatial proximity and conformational changes
These techniques have been successfully applied to similar bacterial respiratory complexes and can be adapted for the A. pleuropneumoniae Na(+)-NQR complex, taking into account the specific biochemical properties of this system .
Na(+)-translocating NADH-quinone reductase plays a significant role in A. pleuropneumoniae pathogenicity through several mechanisms:
Energy metabolism adaptation:
The Na(+)-NQR complex allows the bacterium to maintain energy production under the variable oxygen conditions encountered during infection
This adaptation is crucial during colonization of different microenvironments within the porcine respiratory tract
Stress response:
Research indicates that respiratory chain components including Na(+)-NQR are differentially regulated when A. pleuropneumoniae is exposed to bronchoalveolar fluid, suggesting a role in adaptation to the lung environment
This adaptation may contribute to the bacterium's ability to rapidly overcome porcine pulmonary innate immune defenses
Biofilm formation:
Integration with virulence regulation systems:
Understanding these connections provides important insights into A. pleuropneumoniae pathobiology and may reveal new therapeutic targets for controlling porcine pleuropneumonia.
The study of Na(+)-translocating NADH-quinone reductase in A. pleuropneumoniae infections requires carefully selected experimental models that recapitulate relevant aspects of the disease process:
In vitro models:
Growth in bronchoalveolar fluid (BALF) to mimic the lung environment
Primary porcine respiratory epithelial cell cultures for host-pathogen interaction studies
Biofilm formation assays under various environmental conditions
Neutrophil killing assays to assess survival against innate immune responses
Ex vivo models:
Precision-cut lung slices from porcine lungs maintain tissue architecture
Allow study of bacterial interactions with complex tissue structures
Provide insights into tissue tropism and early infection events
In vivo models:
Natural host (porcine) models provide the most relevant system
Can be used to assess the virulence of nqrE knockout mutants compared to wild-type
Allow evaluation of bacterial dissemination, persistence, and tissue damage
Omics approaches:
Transcriptomics of bacteria recovered from infection models
Proteomic analysis to identify changes in Na(+)-NQR expression during infection
Metabolomic studies to understand energetic adaptations in vivo
These models should be selected based on the specific research question, with consideration of ethical implications, particularly for in vivo studies. The BALF model has been successfully used to identify differentially expressed genes in A. pleuropneumoniae, making it particularly valuable for initial studies of Na(+)-NQR regulation during infection .
Comparative analysis of Na(+)-translocating NADH-quinone reductase subunit E across bacterial species reveals important evolutionary and functional insights:
| Bacterial Species | NqrE Similarity to A. pleuropneumoniae | Functional Differences | Ecological Niche |
|---|---|---|---|
| Vibrio cholerae | ~65% sequence identity | Higher Na+ specificity | Aquatic, intestinal pathogen |
| Haemophilus influenzae | ~78% sequence identity | Similar respiratory function | Respiratory pathogen |
| Pseudomonas aeruginosa | ~45% sequence identity | Can use multiple electron acceptors | Versatile opportunistic pathogen |
| Escherichia coli | Not present (uses NDH-1/NDH-2) | Uses H+ gradient primarily | Intestinal, versatile |
These comparisons highlight several important research findings:
The Na(+)-NQR complex is predominantly found in bacteria that have adapted to sodium-rich environments or those that need to rapidly adjust to changing ion concentrations during infection processes.
A. pleuropneumoniae NqrE shows highest conservation with other respiratory pathogens in the Pasteurellaceae family, suggesting common evolutionary pressures related to adaptation to the respiratory environment.
Critical functional domains involved in sodium translocation and quinone interaction are highly conserved across species, while regions exposed to the periplasm or cytoplasm show greater variability.
Structural predictions based on homology modeling with solved structures (primarily from Vibrio species) suggest similar transmembrane helical arrangements but species-specific differences in surface-exposed loops.
These evolutionary patterns provide insights into the adaptation of A. pleuropneumoniae to its specific host environment and may guide the development of targeted interventions that exploit unique features of this pathogen's respiratory metabolism.
Developing genetic manipulation strategies for nqrE in A. pleuropneumoniae presents several technical challenges that require specialized approaches:
Challenges in creating knockout mutants:
Essential nature of respiratory genes may make complete knockouts lethal
Potential polar effects on other genes in the nqr operon
Limited natural competence of A. pleuropneumoniae
Potential disruption of membrane integrity affecting viability
Methodological solutions:
Conditional knockout systems using inducible promoters
Precise in-frame deletion strategies to avoid polar effects
Use of the chloramphenicol acetyltransferase gene (cat) as a selectable marker, which has been successfully employed for gene replacements in A. pleuropneumoniae
MIV transformation protocols adapted specifically for A. pleuropneumoniae
Site-directed mutagenesis approach:
Target conserved functional residues identified through comparative genomics
Use homologous recombination-based approaches with counter-selectable markers
Consider CRISPR-Cas9 systems adapted for A. pleuropneumoniae
Validate mutants through complementation studies with the wild-type gene
Phenotypic analysis strategy:
Compare growth under various stress conditions (oxidative stress, pH stress, antimicrobial peptides)
Assess changes in membrane potential and ion gradients
Measure respiratory chain activity with various substrates
Evaluate virulence in appropriate infection models
Successful genetic manipulation studies would significantly advance our understanding of Na(+)-NQR complex function in A. pleuropneumoniae pathophysiology and potentially reveal new therapeutic targets.
Purification of functional membrane proteins like Na(+)-translocating NADH-quinone reductase subunit E presents several technical challenges that can be addressed through specialized protocols:
Challenge: Protein aggregation during extraction
Solution:
Screen multiple mild detergents (DDM, LMNG, CHAPS) at varying concentrations
Include stabilizing agents like glycerol (10-20%) and specific lipids in extraction buffers
Perform extraction at reduced temperatures (4°C) with gentle agitation
Challenge: Low yield from expression systems
Solution:
Optimize codon usage for expression host
Try fusion partners that enhance membrane protein expression (e.g., MBP, SUMO)
Explore specialized membrane protein expression strains
Consider scale-up strategies with controlled growth parameters
Challenge: Loss of function during purification
Solution:
Include appropriate cofactors in all purification buffers
Maintain a lipid environment through addition of specific lipids to detergent micelles
Minimize exposure to harsh conditions (extreme pH, high salt, elevated temperatures)
Verify protein functionality at each purification step
Challenge: Removal of affinity tags affecting function
Solution:
Design constructs with cleavable tags separated by flexible linkers
Optimize tag cleavage conditions to minimize protein damage
Compare activity before and after tag removal
Consider leaving the tag intact if removal significantly impacts function
These methodological adjustments should be systematically tested and optimized for the specific properties of the A. pleuropneumoniae NqrE protein, with continuous monitoring of protein quality and functionality throughout the purification process.
Distinguishing between specific and non-specific effects in Na(+)-translocating NADH-quinone reductase inhibition studies requires rigorous experimental design and appropriate controls:
Appropriate control systems:
Use closely related membrane proteins that are not part of the Na(+)-NQR complex
Compare effects on isolated NqrE subunit versus the entire complex
Include bacterial strains with known mutations in the nqrE gene
Test inhibitors against multiple respiratory chain components
Dose-response relationships:
Establish complete dose-response curves rather than single-concentration experiments
Calculate IC50 values for suspected inhibitors
Compare potency against purified protein versus whole cells
Examine the relationship between inhibition of enzyme activity and physiological effects
Binding studies:
Use techniques like isothermal titration calorimetry or microscale thermophoresis to quantify direct binding
Compare binding affinities with functional inhibition potencies
Perform competition assays with known substrates or cofactors
Identify specific binding sites through site-directed mutagenesis
Validation approaches:
Confirm results across multiple experimental systems and conditions
Use structurally diverse inhibitors targeting the same site as additional controls
Apply computational docking and molecular dynamics simulations to predict and verify binding modes
Investigate off-target effects through proteomic or transcriptomic analysis
These approaches collectively provide a robust framework for distinguishing specific inhibitory effects on Na(+)-NQR function from non-specific perturbations of membrane integrity or cellular metabolism.
Several cutting-edge technologies hold promise for deepening our understanding of Na(+)-translocating NADH-quinone reductase structure-function relationships:
These technologies, especially when used in complementary combinations, promise to provide unprecedented insights into how the structure of NqrE and the entire Na(+)-NQR complex relates to its function in bacterial bioenergetics and pathogenesis.
The critical role of Na(+)-translocating NADH-quinone reductase in A. pleuropneumoniae bioenergetics makes it a promising target for novel antimicrobial strategies:
Rational drug design approaches:
Structure-based design of specific inhibitors targeting unique features of A. pleuropneumoniae NqrE
Development of peptidomimetics that disrupt assembly of the Na(+)-NQR complex
Design of suicide substrates that irreversibly modify the active site
Exploration of allosteric inhibitors that lock the complex in inactive conformations
Combination therapy strategies:
Pairing Na(+)-NQR inhibitors with conventional antibiotics to enhance efficacy
Co-targeting multiple respiratory chain components to prevent metabolic adaptation
Combining with inhibitors of biofilm formation for enhanced penetration
Developing adjuvants that increase bacterial reliance on Na(+)-NQR function
Nanoparticle-based delivery systems:
Design of nanocarriers that specifically target A. pleuropneumoniae cells
Development of pH-responsive delivery systems activated in the infection microenvironment
Creation of membrane-disrupting nanoparticles that selectively deliver Na(+)-NQR inhibitors
Engineering of sustained-release formulations for prolonged respiratory tract delivery
Immunological approaches:
Exploration of NqrE epitopes as potential vaccine components
Development of antibodies that inhibit Na(+)-NQR function
Investigation of Na(+)-NQR as a diagnostic biomarker for A. pleuropneumoniae infections
Understanding how Na(+)-NQR modulation affects bacterial immunogenicity
These approaches could lead to novel therapeutics that specifically target A. pleuropneumoniae respiratory metabolism, potentially overcoming challenges of antibiotic resistance while minimizing disruption to the host and commensal microbiota.