Recombinant Actinobacillus pleuropneumoniae serotype 5b Na (+)-translocating NADH-quinone reductase subunit E

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Actinobacillus pleuropneumoniae Serotype 5b Na(+)-translocating NADH-quinone Reductase Subunit E

Recombinant Actinobacillus pleuropneumoniae serotype 5b Na(+)-translocating NADH-quinone reductase subunit E is a recombinant protein derived from the bacterium Actinobacillus pleuropneumoniae, specifically serotype 5b. This protein is part of the Na(+)-translocating NADH-quinone reductase (NQR) complex, which plays a crucial role in energy metabolism and ion homeostasis in bacteria.

Function and Importance of Na(+)-translocating NADH-quinone Reductase

The Na(+)-translocating NADH-quinone reductase complex is essential for the survival and pathogenesis of Actinobacillus pleuropneumoniae. It is involved in generating a sodium gradient across the cell membrane, which is crucial for energy transduction and maintaining cytoplasmic pH homeostasis . In marine and halophilic bacteria, this complex is well-studied for its role in energy metabolism and ion balance.

Characteristics of Recombinant Na(+)-translocating NADH-quinone Reductase Subunit E

  • Species: Actinobacillus pleuropneumoniae serotype 5b (strain L20).

  • Protein Name: Na(+)-translocating NADH-quinone reductase subunit E.

  • Uniprot Number: A3MYM6.

  • Tag Info: The tag type is determined during production.

  • Storage Buffer: Tris-based buffer with 50% glycerol.

  • Storage Conditions: Store at -20°C for extended storage or conserve at -20°C or -80°C. Avoid repeated freezing and thawing.

  • Working Aliquots: Store at 4°C for up to one week .

Role in Pathogenesis

The NQR complex, including subunit E, is crucial for the persistence of Actinobacillus pleuropneumoniae in its host. Studies using signature-tagged mutagenesis have shown that mutations in the nqrB gene, part of the NQR complex, significantly impair the bacterium's ability to survive in vivo .

Use in ELISA Kits

Recombinant Na(+)-translocating NADH-quinone reductase subunit E is used in ELISA kits for detecting antibodies against Actinobacillus pleuropneumoniae serotype 5b. These kits are valuable tools for diagnosing infections and studying immune responses .

Potential in Vaccine Development

Understanding the role of Na(+)-translocating NADH-quinone reductase in pathogenesis could contribute to the development of more effective vaccines against Actinobacillus pleuropneumoniae. By targeting essential proteins like subunit E, researchers may develop novel vaccine candidates .

Table 1: Characteristics of Recombinant Na(+)-translocating NADH-quinone Reductase Subunit E

CharacteristicDescription
SpeciesActinobacillus pleuropneumoniae serotype 5b (strain L20)
Protein NameNa(+)-translocating NADH-quinone reductase subunit E
Uniprot NumberA3MYM6
Storage BufferTris-based buffer with 50% glycerol
Storage ConditionsStore at -20°C or -80°C

Table 2: Amino Acid Sequence Details

Sequence PortionAmino Acid Sequence
Full SequenceMEHYLSLFVKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGIAVIVVLGIAVPANQLVY THVLKDGALVEGVDLSFLNFITFIGVIAALVQILEMILDKFFPALYSALGIFLPLITVNC AIFGGVSFMVQREYNFTESVVYGLGAGTGWmLAIVALAGLTEKMKYSDVPAGLRGLGITF ITVGLMALGFMSFSGIQL

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
nqrE; APL_0154; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Target Names
nqrE
Target Protein Sequence
MEHYLSLFVKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGIAVIVVLGIAVPANQLVY THVLKDGALVEGVDLSFLNFITFIGVIAALVQILEMILDKFFPALYSALGIFLPLITVNC AIFGGVSFMVQREYNFTESVVYGLGAGTGWMLAIVALAGLTEKMKYSDVPAGLRGLGITF ITVGLMALGFMSFSGIQL
Uniprot No.

Target Background

Function

The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol via two sequential reactions coupled with Na+ ion transport from the cytoplasm to the periplasm. NqrA to NqrE proteins are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.

Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Na(+)-translocating NADH-quinone reductase subunit E and what is its role in Actinobacillus pleuropneumoniae?

Na(+)-translocating NADH-quinone reductase subunit E (NqrE) is a membrane protein component of the Na(+)-NQR complex in Actinobacillus pleuropneumoniae. This complex (EC 1.6.5.-) plays a crucial role in the bacterial respiratory chain by coupling NADH oxidation to sodium ion translocation across the membrane, thereby generating an electrochemical gradient used for energy production . In A. pleuropneumoniae serotype 5b (strain L20), this protein is encoded by the nqrE gene (locus APL_0154) and consists of 198 amino acids . The Na(+)-NQR complex is particularly important for energy metabolism in marine and halophilic bacteria, but also plays significant roles in pathogens like A. pleuropneumoniae that must adapt to challenging host environments .

What are the optimal storage and handling conditions for recombinant Na(+)-translocating NADH-quinone reductase subunit E?

The recombinant Na(+)-translocating NADH-quinone reductase subunit E should be stored in a Tris-based buffer with 50% glycerol at -20°C for routine storage, or at -80°C for extended storage periods . Working aliquots can be maintained at 4°C for up to one week to minimize protein degradation from repeated freeze-thaw cycles, which should be avoided as they can significantly reduce protein activity and integrity .

For experimental handling, consider the following protocol:

  • Thaw protein aliquots on ice slowly to maintain structural integrity

  • Maintain protein in buffer conditions that mimic its native environment (considering pH and salt concentration)

  • Avoid extended exposure to room temperature

  • Use freshly prepared aliquots for critical experiments

  • Include protease inhibitors when working with cell lysates or during purification

These precautions are essential because membrane proteins like NqrE are particularly susceptible to denaturation and aggregation when removed from their native lipid environment.

What expression systems are most effective for producing high-quality recombinant Na(+)-translocating NADH-quinone reductase subunit E?

The expression of membrane proteins like Na(+)-translocating NADH-quinone reductase subunit E presents significant challenges due to their hydrophobic nature and requirement for correct membrane insertion. Based on current research methodologies for similar bacterial membrane proteins, the following expression systems have proven effective:

Expression SystemAdvantagesChallengesYield
E. coli BL21(DE3)Fast growth, easy handling, well-established protocolsPotential toxicity, inclusion body formationModerate
C41/C43 E. coli strainsSpecifically designed for membrane proteins, reduced toxicityMore expensive, slower growthHigh
Cell-free systemsAvoids toxicity issues, allows direct incorporation into nanodiscs or liposomesTechnical complexity, higher costVariable
Yeast systems (P. pastoris)Better for complex membrane proteins, glycosylation capabilityLonger development time, complex media requirementsModerate-High

For A. pleuropneumoniae membrane proteins specifically, the addition of specific chaperones and careful optimization of induction conditions (temperature, inducer concentration, and induction time) significantly improves the yield of properly folded protein . The incorporation of affinity tags (typically determined during the production process) facilitates purification while minimizing interference with protein function.

How can researchers effectively incorporate recombinant Na(+)-translocating NADH-quinone reductase subunit E into functional assays?

Incorporating recombinant Na(+)-translocating NADH-quinone reductase subunit E into functional assays requires careful consideration of its native membrane environment. Researchers should consider the following methodological approaches:

  • Reconstitution into liposomes:

    • Prepare lipid mixtures that mimic bacterial membranes (typically phosphatidylglycerol and cardiolipin)

    • Use detergent-mediated reconstitution followed by detergent removal via dialysis or bio-beads

    • Verify incorporation using freeze-fracture electron microscopy or fluorescence-based assays

  • Activity measurement:

    • Monitor NADH oxidation spectrophotometrically at 340 nm

    • Track Na+ translocation using fluorescent indicators like SBFI or radioactive Na+ isotopes

    • Measure quinone reduction using specific quinone analogs

  • Interaction studies:

    • Employ crosslinking approaches with other NQR complex subunits

    • Use surface plasmon resonance to quantify binding kinetics with putative partners

    • Apply microscale thermophoresis for detecting interactions in solution

What techniques are most suitable for studying the interaction between Na(+)-translocating NADH-quinone reductase subunit E and other components of the respiratory chain?

The study of interactions between Na(+)-translocating NADH-quinone reductase subunit E and other respiratory chain components requires specialized techniques suitable for membrane protein complexes:

  • Blue Native PAGE:

    • Preserves native protein-protein interactions

    • Allows visualization of intact complexes

    • Can be combined with second-dimension SDS-PAGE for subunit identification

  • Cryo-Electron Microscopy:

    • Enables structural characterization of the entire NQR complex

    • Reveals interaction interfaces between subunits

    • Provides insights into conformational changes during catalysis

  • Co-immunoprecipitation with specific antibodies:

    • Can pull down intact complexes from solubilized membranes

    • Allows identification of transient interaction partners

    • Compatible with subsequent mass spectrometry analysis

  • FRET-based approaches:

    • Can be used to study dynamic interactions in real-time

    • Requires fluorescent labeling of purified components

    • Provides information about spatial proximity and conformational changes

These techniques have been successfully applied to similar bacterial respiratory complexes and can be adapted for the A. pleuropneumoniae Na(+)-NQR complex, taking into account the specific biochemical properties of this system .

How does Na(+)-translocating NADH-quinone reductase contribute to Actinobacillus pleuropneumoniae virulence and pathogenicity?

Na(+)-translocating NADH-quinone reductase plays a significant role in A. pleuropneumoniae pathogenicity through several mechanisms:

  • Energy metabolism adaptation:

    • The Na(+)-NQR complex allows the bacterium to maintain energy production under the variable oxygen conditions encountered during infection

    • This adaptation is crucial during colonization of different microenvironments within the porcine respiratory tract

  • Stress response:

    • Research indicates that respiratory chain components including Na(+)-NQR are differentially regulated when A. pleuropneumoniae is exposed to bronchoalveolar fluid, suggesting a role in adaptation to the lung environment

    • This adaptation may contribute to the bacterium's ability to rapidly overcome porcine pulmonary innate immune defenses

  • Biofilm formation:

    • Studies have shown connections between energy metabolism genes (including respiratory chain components) and biofilm formation in A. pleuropneumoniae

    • Biofilms contribute significantly to antibiotic resistance and persistence in host tissues

  • Integration with virulence regulation systems:

    • Expression of Na(+)-NQR components may be coordinated with other virulence factors through global regulatory networks

    • Phase variation mechanisms identified in A. pleuropneumoniae may influence expression of metabolic genes including those in the respiratory chain

Understanding these connections provides important insights into A. pleuropneumoniae pathobiology and may reveal new therapeutic targets for controlling porcine pleuropneumonia.

What experimental models are most appropriate for studying the role of Na(+)-translocating NADH-quinone reductase in Actinobacillus pleuropneumoniae infections?

The study of Na(+)-translocating NADH-quinone reductase in A. pleuropneumoniae infections requires carefully selected experimental models that recapitulate relevant aspects of the disease process:

  • In vitro models:

    • Growth in bronchoalveolar fluid (BALF) to mimic the lung environment

    • Primary porcine respiratory epithelial cell cultures for host-pathogen interaction studies

    • Biofilm formation assays under various environmental conditions

    • Neutrophil killing assays to assess survival against innate immune responses

  • Ex vivo models:

    • Precision-cut lung slices from porcine lungs maintain tissue architecture

    • Allow study of bacterial interactions with complex tissue structures

    • Provide insights into tissue tropism and early infection events

  • In vivo models:

    • Natural host (porcine) models provide the most relevant system

    • Can be used to assess the virulence of nqrE knockout mutants compared to wild-type

    • Allow evaluation of bacterial dissemination, persistence, and tissue damage

  • Omics approaches:

    • Transcriptomics of bacteria recovered from infection models

    • Proteomic analysis to identify changes in Na(+)-NQR expression during infection

    • Metabolomic studies to understand energetic adaptations in vivo

These models should be selected based on the specific research question, with consideration of ethical implications, particularly for in vivo studies. The BALF model has been successfully used to identify differentially expressed genes in A. pleuropneumoniae, making it particularly valuable for initial studies of Na(+)-NQR regulation during infection .

How does the structure and function of A. pleuropneumoniae Na(+)-translocating NADH-quinone reductase subunit E compare to homologous proteins in other bacterial pathogens?

Comparative analysis of Na(+)-translocating NADH-quinone reductase subunit E across bacterial species reveals important evolutionary and functional insights:

Bacterial SpeciesNqrE Similarity to A. pleuropneumoniaeFunctional DifferencesEcological Niche
Vibrio cholerae~65% sequence identityHigher Na+ specificityAquatic, intestinal pathogen
Haemophilus influenzae~78% sequence identitySimilar respiratory functionRespiratory pathogen
Pseudomonas aeruginosa~45% sequence identityCan use multiple electron acceptorsVersatile opportunistic pathogen
Escherichia coliNot present (uses NDH-1/NDH-2)Uses H+ gradient primarilyIntestinal, versatile

These comparisons highlight several important research findings:

  • The Na(+)-NQR complex is predominantly found in bacteria that have adapted to sodium-rich environments or those that need to rapidly adjust to changing ion concentrations during infection processes.

  • A. pleuropneumoniae NqrE shows highest conservation with other respiratory pathogens in the Pasteurellaceae family, suggesting common evolutionary pressures related to adaptation to the respiratory environment.

  • Critical functional domains involved in sodium translocation and quinone interaction are highly conserved across species, while regions exposed to the periplasm or cytoplasm show greater variability.

  • Structural predictions based on homology modeling with solved structures (primarily from Vibrio species) suggest similar transmembrane helical arrangements but species-specific differences in surface-exposed loops.

These evolutionary patterns provide insights into the adaptation of A. pleuropneumoniae to its specific host environment and may guide the development of targeted interventions that exploit unique features of this pathogen's respiratory metabolism.

What are the challenges and potential solutions in developing knockout or site-directed mutagenesis studies of nqrE in Actinobacillus pleuropneumoniae?

Developing genetic manipulation strategies for nqrE in A. pleuropneumoniae presents several technical challenges that require specialized approaches:

  • Challenges in creating knockout mutants:

    • Essential nature of respiratory genes may make complete knockouts lethal

    • Potential polar effects on other genes in the nqr operon

    • Limited natural competence of A. pleuropneumoniae

    • Potential disruption of membrane integrity affecting viability

  • Methodological solutions:

    • Conditional knockout systems using inducible promoters

    • Precise in-frame deletion strategies to avoid polar effects

    • Use of the chloramphenicol acetyltransferase gene (cat) as a selectable marker, which has been successfully employed for gene replacements in A. pleuropneumoniae

    • MIV transformation protocols adapted specifically for A. pleuropneumoniae

  • Site-directed mutagenesis approach:

    • Target conserved functional residues identified through comparative genomics

    • Use homologous recombination-based approaches with counter-selectable markers

    • Consider CRISPR-Cas9 systems adapted for A. pleuropneumoniae

    • Validate mutants through complementation studies with the wild-type gene

  • Phenotypic analysis strategy:

    • Compare growth under various stress conditions (oxidative stress, pH stress, antimicrobial peptides)

    • Assess changes in membrane potential and ion gradients

    • Measure respiratory chain activity with various substrates

    • Evaluate virulence in appropriate infection models

Successful genetic manipulation studies would significantly advance our understanding of Na(+)-NQR complex function in A. pleuropneumoniae pathophysiology and potentially reveal new therapeutic targets.

What are common challenges in purifying functional recombinant Na(+)-translocating NADH-quinone reductase subunit E and how can they be addressed?

Purification of functional membrane proteins like Na(+)-translocating NADH-quinone reductase subunit E presents several technical challenges that can be addressed through specialized protocols:

  • Challenge: Protein aggregation during extraction
    Solution:

    • Screen multiple mild detergents (DDM, LMNG, CHAPS) at varying concentrations

    • Include stabilizing agents like glycerol (10-20%) and specific lipids in extraction buffers

    • Perform extraction at reduced temperatures (4°C) with gentle agitation

  • Challenge: Low yield from expression systems
    Solution:

    • Optimize codon usage for expression host

    • Try fusion partners that enhance membrane protein expression (e.g., MBP, SUMO)

    • Explore specialized membrane protein expression strains

    • Consider scale-up strategies with controlled growth parameters

  • Challenge: Loss of function during purification
    Solution:

    • Include appropriate cofactors in all purification buffers

    • Maintain a lipid environment through addition of specific lipids to detergent micelles

    • Minimize exposure to harsh conditions (extreme pH, high salt, elevated temperatures)

    • Verify protein functionality at each purification step

  • Challenge: Removal of affinity tags affecting function
    Solution:

    • Design constructs with cleavable tags separated by flexible linkers

    • Optimize tag cleavage conditions to minimize protein damage

    • Compare activity before and after tag removal

    • Consider leaving the tag intact if removal significantly impacts function

These methodological adjustments should be systematically tested and optimized for the specific properties of the A. pleuropneumoniae NqrE protein, with continuous monitoring of protein quality and functionality throughout the purification process.

How can researchers differentiate between specific and non-specific effects when studying Na(+)-translocating NADH-quinone reductase inhibition in experimental settings?

Distinguishing between specific and non-specific effects in Na(+)-translocating NADH-quinone reductase inhibition studies requires rigorous experimental design and appropriate controls:

  • Appropriate control systems:

    • Use closely related membrane proteins that are not part of the Na(+)-NQR complex

    • Compare effects on isolated NqrE subunit versus the entire complex

    • Include bacterial strains with known mutations in the nqrE gene

    • Test inhibitors against multiple respiratory chain components

  • Dose-response relationships:

    • Establish complete dose-response curves rather than single-concentration experiments

    • Calculate IC50 values for suspected inhibitors

    • Compare potency against purified protein versus whole cells

    • Examine the relationship between inhibition of enzyme activity and physiological effects

  • Binding studies:

    • Use techniques like isothermal titration calorimetry or microscale thermophoresis to quantify direct binding

    • Compare binding affinities with functional inhibition potencies

    • Perform competition assays with known substrates or cofactors

    • Identify specific binding sites through site-directed mutagenesis

  • Validation approaches:

    • Confirm results across multiple experimental systems and conditions

    • Use structurally diverse inhibitors targeting the same site as additional controls

    • Apply computational docking and molecular dynamics simulations to predict and verify binding modes

    • Investigate off-target effects through proteomic or transcriptomic analysis

These approaches collectively provide a robust framework for distinguishing specific inhibitory effects on Na(+)-NQR function from non-specific perturbations of membrane integrity or cellular metabolism.

What emerging technologies could advance our understanding of Na(+)-translocating NADH-quinone reductase structure-function relationships?

Several cutting-edge technologies hold promise for deepening our understanding of Na(+)-translocating NADH-quinone reductase structure-function relationships:

These technologies, especially when used in complementary combinations, promise to provide unprecedented insights into how the structure of NqrE and the entire Na(+)-NQR complex relates to its function in bacterial bioenergetics and pathogenesis.

How might understanding Na(+)-translocating NADH-quinone reductase contribute to novel antimicrobial strategies against Actinobacillus pleuropneumoniae?

The critical role of Na(+)-translocating NADH-quinone reductase in A. pleuropneumoniae bioenergetics makes it a promising target for novel antimicrobial strategies:

  • Rational drug design approaches:

    • Structure-based design of specific inhibitors targeting unique features of A. pleuropneumoniae NqrE

    • Development of peptidomimetics that disrupt assembly of the Na(+)-NQR complex

    • Design of suicide substrates that irreversibly modify the active site

    • Exploration of allosteric inhibitors that lock the complex in inactive conformations

  • Combination therapy strategies:

    • Pairing Na(+)-NQR inhibitors with conventional antibiotics to enhance efficacy

    • Co-targeting multiple respiratory chain components to prevent metabolic adaptation

    • Combining with inhibitors of biofilm formation for enhanced penetration

    • Developing adjuvants that increase bacterial reliance on Na(+)-NQR function

  • Nanoparticle-based delivery systems:

    • Design of nanocarriers that specifically target A. pleuropneumoniae cells

    • Development of pH-responsive delivery systems activated in the infection microenvironment

    • Creation of membrane-disrupting nanoparticles that selectively deliver Na(+)-NQR inhibitors

    • Engineering of sustained-release formulations for prolonged respiratory tract delivery

  • Immunological approaches:

    • Exploration of NqrE epitopes as potential vaccine components

    • Development of antibodies that inhibit Na(+)-NQR function

    • Investigation of Na(+)-NQR as a diagnostic biomarker for A. pleuropneumoniae infections

    • Understanding how Na(+)-NQR modulation affects bacterial immunogenicity

These approaches could lead to novel therapeutics that specifically target A. pleuropneumoniae respiratory metabolism, potentially overcoming challenges of antibiotic resistance while minimizing disruption to the host and commensal microbiota.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.