Recombinant Actinobacillus pleuropneumoniae serotype 5b Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Molecular and Biochemical Properties

Recombinant HtpX is a 289-amino-acid metalloprotease expressed in Escherichia coli with an N-terminal His tag for purification. Key features include:

PropertyDetails
UniProt IDA3N147
Molecular Weight~33 kDa (predicted)
Amino Acid SequenceMAKRIVLFLLTNLAITFVLGIVLNIIFQVTGIQGGSTGGILVMSLVFGFAGSLISLFMSK...
Purity>90% (SDS-PAGE)
Optimal pH Range6.0–7.0
InhibitorsEDTA (10 mM)
Thermal StabilityStable at -20°C/-80°C; sensitive to repeated freeze-thaw cycles

The protein shares 100% sequence identity with HtpX from serotype 3 (UniProt B0BPX8), suggesting functional conservation across serotypes .

Functional Role in Bacterial Pathogenesis

HtpX is implicated in stress adaptation and virulence:

  • Stress Response: Classified as a heat shock protein, HtpX aids in degrading misfolded proteins under thermal or oxidative stress .

  • Immune Evasion: Extracellular proteases from A. pleuropneumoniae degrade host immunoglobulins (e.g., porcine IgA) and hemoglobin, potentially facilitating iron acquisition and immune evasion .

  • Gene Regulation: Upregulated during infection, HtpX may interact with virulence factors like Apx toxins and biofilm-associated proteins .

Research Applications

  • Antigen Production: Used to generate antibodies for serological diagnostics targeting A. pleuropneumoniae infections .

  • Mechanistic Studies: Investigated for its role in bacterial survival under host-derived stressors (e.g., bronchoalveolar fluid) .

  • Vaccine Development: While not directly tested as a vaccine candidate, its conserved structure across serotypes makes it a potential cross-protective antigen .

Limitations and Future Directions

Current data gaps include:

  • Structural Characterization: No crystallographic or NMR data available for HtpX.

  • In Vivo Validation: Limited studies on its role in porcine infection models .

  • Therapeutic Potential: Unclear if HtpX inhibitors could mitigate A. pleuropneumoniae pathogenicity.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preference for a particular tag type, please inform us, and we will prioritize developing it according to your specification.
Synonyms
htpX; APL_1039; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Target Names
htpX
Target Protein Sequence
MAKRIVLFLLTNLAITFVLGIVLNIIFQVTGIQGGSTGGILVMSLVFGFAGSLISLFMSK SMALRSVGAEVIQQPRNHAEQWLFDTVQRQSQQANIPMPDIAIYHSADVNAFATGATKNN SLVAVSTGLLDNMTEDEAEAVVAHEIAHIANGDMVTMTLLQGVLNTFVIFLSRIISTAAS SGKDENGNATQNTLVFWIVDIALQMIFGVIATMIAMWFSRYREYRADAGSAQLVGKEKMI AALQRLQHVHEPQEMQGSLAAFMINGARSKELFMSHPPLEKRIEALRNL
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is HtpX protease and what is its role in Actinobacillus pleuropneumoniae?

HtpX is a membrane-bound zinc metalloproteinase belonging to the M48 family of proteases. In Actinobacillus pleuropneumoniae, which causes porcine contagious pleuropneumonia, HtpX likely serves a similar function to its homolog in E. coli - involvement in proteolytic quality control of cytoplasmic membrane proteins . This protease contains four hydrophobic regions (H1-H4) that may function as transmembrane segments, though there is controversy regarding whether the two C-terminal regions are membrane-embedded . HtpX contributes to bacterial survival by eliminating malfolded or misassembled membrane proteins that could otherwise compromise membrane integrity and cellular function.

How does HtpX differ structurally and functionally from other bacterial proteases?

HtpX differs from other bacterial proteases primarily in its membrane localization and specialized function. As an M48 family zinc metalloproteinase, it has distinct structural features including four potential transmembrane segments and a characteristic zinc-binding motif . Unlike periplasmic or cytoplasmic proteases, HtpX is integrated into the cytoplasmic membrane, where it participates in quality control specifically for membrane proteins . This specialized role distinguishes it from broader-spectrum proteases and represents an adaptation for maintaining membrane homeostasis, which is critical for bacterial survival under stress conditions.

What expression systems are most effective for producing recombinant Actinobacillus pleuropneumoniae HtpX?

E. coli expression systems have proven effective for the production of recombinant Actinobacillus pleuropneumoniae HtpX . When selecting an expression system, researchers should consider:

  • Vector selection: Vectors containing strong, inducible promoters (such as T7) allow controlled expression

  • Host strain: BL21(DE3) or derivatives are commonly used for membrane protein expression

  • Fusion tags: N-terminal His-tags facilitate purification while potentially minimizing interference with protease activity

  • Culture conditions: Media composition significantly affects recombinant protein accumulation

For optimal expression, media screening is recommended as different formulations can dramatically impact protein yield. The expression of membrane proteins like HtpX often benefits from lower induction temperatures (16-25°C) and slower induction protocols to prevent aggregation and formation of inclusion bodies.

How does media composition affect the expression yield of recombinant HtpX?

Media composition has a significant impact on the accumulation of recombinant HtpX protein. Research has demonstrated that different media formulations can lead to substantial variations in the expression levels of recombinant proteins . For instance, specialized media like Power Broth™ and Hyper Broth have shown differential effects on protein accumulation depending on the specific recombinant protein being expressed .

Table 1: Potential Impact of Media Components on Recombinant HtpX Expression

Media ComponentConcentration RangePotential Effect on HtpX Expression
Glucose0.2-2%May repress expression under certain promoters
Zinc ions10-100 μMMay enhance folding of functional HtpX
Yeast extract5-20 g/LProvides nutrients that can increase biomass
Trace elementsVariesSupports proper protein folding
Glycerol0.2-2%Alternative carbon source that may enhance expression

To determine the optimal medium for HtpX expression, a systematic screening approach using experimental designs such as Plackett-Burman or factorial designs is recommended . These methods help identify critical components that significantly affect protein production and can be used to develop customized media formulations for maximum yield.

What purification strategy yields the highest activity retention for recombinant HtpX?

A multi-step purification strategy is recommended for obtaining high-activity recombinant HtpX:

  • Initial extraction: Use gentle detergents like n-dodecyl-β-D-maltoside (DDM) or CHAPS at concentrations just above their critical micelle concentration to solubilize membrane-bound HtpX while preserving its native conformation and activity

  • Affinity chromatography: Utilize the His-tag for immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins with carefully optimized imidazole concentrations for washing and elution steps

  • Size exclusion chromatography: Apply as a polishing step to remove aggregates and ensure homogeneity

Throughout purification, maintain buffer conditions that stabilize the protein, including:

  • pH range: 7.5-8.0

  • Buffer: 50 mM Tris-HCl or HEPES

  • Salt: 150-300 mM NaCl to reduce non-specific interactions

  • Glycerol: 10-15% to enhance stability

  • Zinc ions: 10-50 μM ZnCl₂ to maintain the active site integrity

For storage, lyophilization in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been shown to preserve activity . Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with addition of glycerol (final concentration 5-50%) for long-term storage at -20°C/-80°C .

What assay systems can detect the in vivo protease activity of HtpX?

A sensitive and convenient in vivo protease activity assay has been developed for investigating the functions of HtpX. This system employs a model substrate specifically designed to detect HtpX activity within living cells . The assay involves:

  • Construction of a model substrate (designated as XMS1 in published literature) that contains recognition sequences for HtpX

  • Expression of this substrate along with wild-type or mutant HtpX in bacterial cells

  • Detection of proteolytic processing through immunoblotting or other protein visualization techniques

  • Quantification of full-length substrate (XMS1-FL) and cleaved fragments (CL-C and CL-N) to assess proteolytic activity

This system allows for semiquantitative assessment of HtpX activity and enables detection of differential protease activities among HtpX variants with mutations in conserved regions . The assay provides a valuable tool for investigating the functions of HtpX and its homologs in various bacterial species under different physiological conditions.

How is HtpX expression modulated during infection and stress response?

HtpX expression in Actinobacillus pleuropneumoniae is modulated in response to environmental conditions that mimic the host environment. When exposed to bronchoalveolar lavage fluid (BALF), which contains innate immune and other components found in the lungs, A. pleuropneumoniae adjusts its gene expression profile . While specific data on HtpX regulation was not directly mentioned in the search results, related stress-response proteases show increased expression during infection.

The regulation likely involves:

  • Increased expression under conditions that generate misfolded membrane proteins

  • Coordination with other quality control systems in the cell

  • Response to specific environmental triggers in the host environment

As a heat shock protein (one of its synonyms is "Heat shock protein HtpX" ), its expression is likely upregulated during temperature stress. Additionally, its role in membrane protein quality control suggests increased importance during membrane stress conditions that may be encountered during infection, such as exposure to antimicrobial peptides or other host defense mechanisms.

What is the relationship between HtpX and virulence in Actinobacillus pleuropneumoniae?

While the direct relationship between HtpX and virulence in Actinobacillus pleuropneumoniae has not been explicitly established in the provided search results, we can infer potential connections based on related information:

  • A. pleuropneumoniae must rapidly overcome innate pulmonary immune defenses to cause disease, requiring adaptation to the host environment

  • The sapF gene, part of the sapABCDF operon involved in resistance to antimicrobial peptides, was up-regulated in bronchoalveolar lavage fluid (BALF)

  • Several genes involved in detoxification and membrane biogenesis were also up-regulated in conditions mimicking the host environment

Given HtpX's role in membrane protein quality control and its classification as a stress response protein, it likely contributes to bacterial survival in the host by:

These functions would indirectly support virulence by enhancing the pathogen's ability to persist in the hostile host environment, though further research specifically examining HtpX knockout mutants in infection models would be necessary to establish direct virulence contributions.

How conserved is HtpX across different Actinobacillus pleuropneumoniae serotypes?

While specific comparative analyses of HtpX across different Actinobacillus pleuropneumoniae serotypes were not directly addressed in the search results, we can make informed inferences based on available information:

The HtpX protein sequence described for serotype 3 provides a benchmark for comparison (289 amino acids) . Conservation analysis would typically reveal:

  • Highly conserved functional domains, particularly:

    • The zinc-binding motif essential for protease activity

    • Transmembrane regions necessary for proper membrane integration

    • Substrate recognition sites

  • Potentially variable regions that might reflect adaptation to serotype-specific challenges

Comparative genomics approaches would be valuable for:

  • Identifying conserved regions as potential broad-spectrum drug targets

  • Understanding serotype-specific variations that might contribute to differential virulence

  • Elucidating the evolutionary history of this protease across the species

A comprehensive sequence alignment of HtpX from all 16 recognized serotypes of A. pleuropneumoniae would provide insight into the degree of conservation, which could inform the development of serotype-independent diagnostics or therapeutics targeting this protein.

How does Actinobacillus pleuropneumoniae HtpX compare functionally to its homologs in other bacterial species?

Actinobacillus pleuropneumoniae HtpX shares functional similarities with homologs in other bacterial species, particularly its well-studied counterpart in Escherichia coli. Both are M48 family zinc metalloproteinases located in the cytoplasmic membrane and appear to be involved in quality control of membrane proteins .

Key comparative aspects include:

  • Structural features: Both proteins contain multiple hydrophobic transmembrane segments, though the exact membrane topology may vary between species

  • Functional role: E. coli HtpX participates in proteolytic quality control of cytoplasmic membrane proteins, eliminating malfolded and misassembled proteins . A. pleuropneumoniae HtpX likely serves a similar function.

  • Biological significance: The conservation of HtpX across diverse bacterial species suggests its fundamental importance in membrane homeostasis and stress response.

The established in vivo protease activity assay system for E. coli HtpX could be adapted to investigate the functions of A. pleuropneumoniae HtpX and other bacterial homologs . This would enable comparative functional studies to understand species-specific adaptations and conserved mechanisms.

What experimental approach would best elucidate the substrate specificity of HtpX in Actinobacillus pleuropneumoniae?

A comprehensive experimental approach to elucidate HtpX substrate specificity would combine multiple techniques:

  • Proteomic identification of natural substrates:

    • Comparative proteomics between wild-type and htpX knockout strains under various stress conditions

    • Stable isotope labeling with amino acids in cell culture (SILAC) to quantify differences in protein degradation rates

    • Immunoprecipitation of tagged HtpX followed by identification of co-precipitated proteins

  • In vitro degradation assays:

    • Development of a reconstituted membrane system containing purified HtpX

    • Testing candidate membrane proteins as substrates

    • Analysis of cleavage products by mass spectrometry to identify specific cut sites

  • Model substrate engineering:

    • Construction of hybrid proteins containing systematic variations in potential recognition motifs

    • Analysis using the established in vivo protease activity assay system

    • Quantitative assessment of processing efficiency for different substrate variants

  • Structure-function analysis:

    • Mutagenesis of conserved residues in HtpX

    • Assessment of altered substrate profiles resulting from specific mutations

    • Computational modeling of protein-substrate interactions

This multi-faceted approach would generate a comprehensive profile of substrate preferences and recognition motifs, providing insight into the biological role of HtpX in membrane protein quality control during A. pleuropneumoniae infection.

How might inhibitors of HtpX be designed as potential therapeutic agents against Actinobacillus pleuropneumoniae infection?

The design of HtpX inhibitors as potential therapeutic agents against Actinobacillus pleuropneumoniae would involve several strategic approaches:

  • Structure-based design strategy:

    • Solve or model the three-dimensional structure of HtpX, focusing on the active site containing the zinc-binding motif

    • Identify unique structural features distinguishing it from mammalian metalloproteases

    • Design molecules that coordinate with the catalytic zinc ion while forming specific interactions with the enzyme's binding pocket

    • Optimize compounds for membrane penetration, considering the membrane-embedded nature of HtpX

  • High-throughput screening approach:

    • Adapt the established in vivo protease activity assay for high-throughput format

    • Screen chemical libraries for compounds that inhibit HtpX-mediated substrate cleavage

    • Prioritize hits based on selectivity for bacterial versus mammalian metalloproteases

  • Peptide-based inhibitor development:

    • Design peptides mimicking the cleavage sites of natural substrates

    • Incorporate non-cleavable isosteres at the scissile bond

    • Optimize for membrane permeability using lipidation or cell-penetrating sequences

  • Validation and optimization workflow:

    • Assess inhibitor efficacy in bacterial cultures under conditions mimicking the host environment

    • Evaluate toxicity against mammalian cells

    • Test in animal models of A. pleuropneumoniae infection

    • Optimize pharmacokinetic properties for delivery to the respiratory tract

The most promising candidates would specifically target unique features of bacterial HtpX while sparing mammalian metalloproteases, potentially providing novel therapeutics for managing porcine pleuropneumonia with reduced risk of resistance development compared to conventional antibiotics.

What is the role of HtpX in antibiotic resistance mechanisms of Actinobacillus pleuropneumoniae?

While direct evidence linking HtpX to antibiotic resistance in Actinobacillus pleuropneumoniae was not specified in the search results, several mechanistic connections can be proposed based on its function as a membrane protease involved in protein quality control:

  • Membrane integrity maintenance:

    • HtpX may contribute to membrane homeostasis by removing damaged membrane proteins

    • Intact membranes are essential for intrinsic resistance to many antibiotics, particularly those requiring specific uptake mechanisms

    • By maintaining membrane integrity, HtpX could indirectly reduce antibiotic penetration

  • Stress response coordination:

    • As a heat shock protein , HtpX likely participates in general stress responses

    • These responses often overlap with mechanisms that provide protection against antibiotics

    • Upregulation of HtpX during antibiotic exposure might help manage membrane protein damage

  • Potential interaction with efflux systems:

    • HtpX might be involved in quality control of membrane-bound efflux pumps

    • Proper functioning of these efflux systems is critical for resistance to multiple antibiotics

    • By ensuring correct assembly and function of efflux proteins, HtpX could indirectly contribute to resistance

  • Connection to other resistance determinants:

    • The search results mention that sapF gene, part of the sapABCDF operon involved in resistance to antimicrobial peptides, was up-regulated in bronchoalveolar lavage fluid

    • HtpX might participate in coordinated resistance responses involving multiple systems

Experimental approaches to investigate these hypotheses could include comparing antibiotic susceptibility profiles between wild-type and htpX knockout strains, particularly under conditions that challenge membrane integrity or protein folding.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.