Recombinant Actinobacillus pleuropneumoniae serotype 7 Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Description

Introduction to Actinobacillus pleuropneumoniae

Actinobacillus pleuropneumoniae is a gram-negative bacterial pathogen responsible for porcine pleuropneumonia, a highly contagious respiratory disease causing significant economic losses in the swine industry worldwide . This bacterium demonstrates remarkable metabolic adaptability, particularly in its capacity to grow under anaerobic conditions, which contributes significantly to its persistence in the lung environment . A. pleuropneumoniae has been classified into 12 different serotypes based on capsular polysaccharide antigens, with serotype 7 being among those that demonstrate significant virulence in swine populations .

The pathogen employs sophisticated mechanisms to obtain essential nutrients within the host environment. Under iron-limiting conditions, A. pleuropneumoniae expresses various proteins involved in iron acquisition, including transferrin binding proteins that have been documented as virulence factors . Besides iron acquisition systems, the bacterium's ability to adapt to oxygen-limited environments through anaerobic respiration represents another critical survival mechanism during infection.

A. pleuropneumoniae infections pose diagnostic challenges due to antigenic cross-reactivity, particularly in serological detection methods. While enzyme-linked immunosorbent assays (ELISAs) have improved detection sensitivity and specificity, cross-reactions between various A. pleuropneumoniae serotypes and other bacterial species remain problematic . These cross-reactions are often attributed to common epitopes in outer membrane proteins and lipopolysaccharide structures.

The Fumarate Reductase Complex: Structure and Function

The fumarate reductase complex in A. pleuropneumoniae is encoded by the frdABCD operon, comprising four distinct subunits that work together to catalyze the terminal electron transfer reaction in anaerobic respiration . This enzyme complex facilitates the reduction of fumarate to succinate, serving as the final step in an electron transport chain that generates a proton gradient for ATP synthesis under anaerobic conditions.

Fumarate reductase subunit D (frdD) functions as one of the membrane anchor proteins within this complex, playing a crucial role in positioning the enzyme appropriately within the bacterial membrane. While the search results don't provide specific details about the molecular structure of frdD in A. pleuropneumoniae serotype 7, bacterial fumarate reductase complexes typically consist of:

  1. FrdA - The catalytic flavoprotein subunit containing the FAD cofactor

  2. FrdB - An iron-sulfur protein subunit mediating electron transfer

  3. FrdC and FrdD - Membrane anchor subunits containing heme groups

Metabolic Role of Fumarate Reductase in A. pleuropneumoniae

The fumarate reductase system in A. pleuropneumoniae operates within a sophisticated metabolic network regulated in part by the ArcAB two-component system, which is crucial for anaerobic adaptation . Analysis of the ArcA regulon in this bacterium reveals a coordinated regulation pattern focused on channeling metabolites toward fumarate synthesis and utilization.

In A. pleuropneumoniae, the metabolic pathway appears to be oriented toward using fumarate as the terminal electron acceptor, with glycerol-3-phosphate serving as the primary electron donor. The bacterium appears to synthesize fumarate from dihydroxyacetone phosphate (the oxidation product of glycerol-3-phosphate) through glycolysis, with phosphoenolpyruvate subsequently entering the reductive branch of the citric acid cycle to generate fumarate .

Research indicates that A. pleuropneumoniae lacks a complete oxidative branch of the citric acid cycle, missing homologues for citrate synthase, aconitase, and isocitrate dehydrogenase . This metabolic arrangement suggests that the bacterium heavily depends on the reductive pathway involving fumarate reductase not only for energy generation but also for producing essential metabolic intermediates.

Table 2: Key Metabolic Enzymes and Their Regulation in A. pleuropneumoniae Anaerobic Respiration

EnzymeFunctionRegulation by ArcARole in Fumarate Metabolism
Glycerol-3-phosphate dehydrogenase (GlpABC)Oxidizes glycerol-3-phosphate to dihydroxyacetone phosphateUpregulated >2-foldProvides electron donor for fumarate reduction
Pyruvate dehydrogenase complex (AceE, AceF, LpdA)Converts pyruvate to acetyl-CoADownregulated ~3-foldReduced consumption of pyruvate preserves carbon for fumarate synthesis
Malate quinone oxidoreductase (Mqo)Converts malate to oxaloacetateDownregulated 20-foldReduced oxidation of malate preserves carbon for fumarate production
Malic enzyme (MaeB)Catalyzes oxidative decarboxylation of malate to pyruvateDownregulated 4.6-foldReduced consumption of malate preserves carbon for fumarate synthesis
Fumarate reductase (FrdABCD)Reduces fumarate to succinateConstitutively expressedTerminal electron acceptor in anaerobic respiration

The midpoint potentials for the glycerol-3-phosphate/dihydroxyacetone phosphate and fumarate/succinate redox pairs are -0.19 V and 0 V, respectively . This electrochemical difference enables energy conservation through the coupled electron transfer, establishing a proton gradient across the bacterial membrane for ATP synthesis.

Virulence Association of Fumarate Reductase

Research has established a significant link between fumarate reductase activity and A. pleuropneumoniae virulence. Studies using an isogenic A. pleuropneumoniae Δfrd deletion mutant demonstrated attenuated virulence in a pig aerosol infection model . While clinical and reisolation scores showed clear but not statistically significant reductions, the lung lesion score was significantly decreased (p ≤ 0.05) in the mutant-infected animals.

Notably, the quality of lung lesions differed markedly between wild-type and mutant infections. Pigs infected with the A. pleuropneumoniae Δfrd mutant exhibited only mild bronchiolo-interstitial pneumonia, whereas animals infected with the wild-type strain developed severe fibrinous pleuropneumonia and moderate focal purulent pneumonia with abscess formation . These pathological differences persisted through day 7 and day 21 post-infection, suggesting a sustained impact of fumarate reductase on disease progression.

Table 3: Impact of Fumarate Reductase Deletion on A. pleuropneumoniae Pathogenicity

ParameterWild-type A. pleuropneumoniaeA. pleuropneumoniae Δfrd MutantStatistical Significance
Clinical ScoreHigherReducedNot significant
Reisolation ScoreHigherReducedNot significant
Lung Lesion ScoreHigherSignificantly reducedp ≤ 0.05
Lung PathologySevere fibrinous pleuropneumonia with abscess formationMild bronchiolo-interstitial pneumoniaQualitatively different
PersistenceSustained infectionReduced persistenceObserved through day 21

The essential role of fumarate reductase in bacterial virulence extends beyond A. pleuropneumoniae. Similar findings have been reported for Helicobacter pylori, where fumarate reductase has been hypothesized to provide the energy required for the bacterium to penetrate the mucus layer of gastric epithelia . By analogy, A. pleuropneumoniae's fumarate reductase likely provides crucial energy for colonization and persistence on the respiratory epithelium.

Therapeutic Potential and Inhibitor Development

The identification of fumarate reductase as a virulence factor opens promising avenues for therapeutic intervention against A. pleuropneumoniae infections. Since higher eukaryotes lack homologues to the bacterial fumarate reductase enzyme complex, this protein represents an attractive target for developing selective antimicrobial agents .

Several inhibitors of fumarate reductase have been identified, although their therapeutic application remains limited. Nafuredin, a novel anthelminthic substance that inhibits fumarate reductase, has shown promise in experimental Haemonchus contortus infections in sheep . The potential application of this or similar compounds against bacterial pathogens like A. pleuropneumoniae warrants further investigation.

Table 4: Potential Fumarate Reductase Inhibitors and Their Applications

InhibitorTargetCurrent ApplicationsPotential Use Against A. pleuropneumoniae
NafuredinHelminthal and bacterial fumarate reductaseTreatment of experimental H. contortus infections in sheepPotential novel therapeutic for A. pleuropneumoniae infections
Other known inhibitorsH. pylori fumarate reductaseResearch use onlyNot suitable for therapeutic use based on current formulations
Future derivativesBacterial fumarate reductaseUnder developmentTargeted therapy for respiratory infections

The development of fumarate reductase inhibitors as therapeutic agents could address the growing concern of antimicrobial resistance in veterinary medicine. By targeting metabolic pathways essential for bacterial survival in host tissues rather than general growth mechanisms, such inhibitors might offer selective activity against pathogens in their infection microenvironments.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
frdD; APP7_1587; Fumarate reductase subunit D; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Target Names
frdD
Target Protein Sequence
MNKQDPKRSNEPPVWLMFSAGGTISAICFPVLLLILGVLLPLGLVPVENIVAFAHTWFGK LVILAVTIFPMWAGMHRVHHGLHDLKIHFPAGGWVFYGLSALYSVIVFFAVIAL
Uniprot No.

Target Background

Function
Anchors the catalytic components of the fumarate reductase complex to the cell membrane and binds quinones.
Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Actinobacillus pleuropneumoniae and its significance in veterinary research?

Actinobacillus pleuropneumoniae is a bacterial pathogen that causes both acute and chronic forms of porcine contagious pleuropneumonia (PCP) in swine . The infection leads to severe respiratory illness characterized by fibrinous pleuropneumonia. App infections have significant economic impact on the global swine industry due to mortality, reduced growth rates, and costs associated with treatment and prevention .

Fifteen different serotypes of App have been identified, with geographic variation in prevalence. Serotype 7 is among the important serotypes that have been used in developing cross-serotype protection strategies and genomic expression libraries for vaccine candidate screening .

What is fumarate reductase and what role does it play in bacterial metabolism?

Fumarate reductase is a respiratory membrane protein complex that catalyzes the reduction of fumarate to succinate, a reaction that is part of anaerobic electron transport chains in many bacteria. This enzyme enables bacteria to grow with various electron donor substrates such as formate or hydrogen under oxygen-limited conditions .

In respiratory pathways, fumarate reductase functions as a terminal electron acceptor during anaerobic respiration, allowing bacteria to generate energy when oxygen is limited, such as in infected host tissues. The enzyme typically consists of multiple subunits, with the D subunit often serving as a membrane anchor component that facilitates electron transport through the membrane.

What are the optimal conditions for recombinant expression of App frdD?

For successful recombinant expression of App frdD, researchers should consider:

Expression Systems:

  • E. coli strains specialized for membrane proteins (C41/C43)

  • Controlled expression using inducible promoters (T7 with IPTG induction)

  • Co-expression with chaperones to improve folding

Expression Conditions:

  • Lower temperatures (16-20°C) to reduce inclusion body formation

  • Reduced inducer concentration (0.1-0.3 mM IPTG)

  • Extended expression periods (16-24 hours)

  • Media supplementation with heme precursors if the protein binds heme

Fusion Strategies:

  • N-terminal fusion with solubility enhancers (MBP, SUMO, Trx)

  • Addition of purification tags that minimally impact function (His6, Strep-tag II)

The most successful strategies typically involve careful optimization of these parameters based on initial expression screening experiments.

What purification approaches yield functional App frdD protein?

Purification of membrane proteins like App frdD requires specific approaches:

  • Membrane Isolation: Differential centrifugation to separate cell membranes containing overexpressed frdD

  • Solubilization: Careful selection of detergents:

    • Milder detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG)

    • Critical micelle concentration (CMC) control to prevent protein denaturation

    • Solubilization buffers containing glycerol (10-20%) and salt (300-500 mM NaCl)

  • Chromatography Sequence:

    • IMAC (Immobilized Metal Affinity Chromatography) for initial capture

    • Ion exchange chromatography for intermediate purification

    • Size exclusion chromatography for final polishing and buffer exchange

  • Stability Considerations:

    • Maintain detergent above CMC throughout purification

    • Include stabilizing agents (glycerol, reducing agents)

    • Consider lipid supplementation or reconstitution into nanodiscs for long-term stability

Careful attention to these methodological details is critical for obtaining functionally active protein suitable for downstream applications.

How can researchers assess the functional activity of recombinant App frdD?

Assessment of fumarate reductase activity can be performed through several complementary approaches:

Spectrophotometric Assays:

  • Monitoring oxidation of artificial electron donors like reduced benzyl viologen (λ = 578 nm)

  • Following quinol oxidation directly (if using physiological electron donors)

  • Succinate dehydrogenase activity (reverse reaction) coupled to artificial electron acceptors

Binding Studies:

  • Isothermal titration calorimetry to measure binding of substrates or inhibitors

  • Fluorescence-based binding assays for quinone interaction

Functional Complementation:

  • Restoration of anaerobic growth in E. coli frd-deficient strains

  • Membrane potential generation in reconstituted systems

Structural Integrity:

  • Circular dichroism to assess secondary structure

  • Thermal shift assays to evaluate protein stability

These methodologies provide a comprehensive assessment of both protein quality and functional activity.

What are the main challenges in studying App frdD and how can they be addressed?

Researchers face several challenges when working with App frdD:

Expression and Purification Challenges:

  • Membrane protein expression often results in low yields

  • Maintaining native conformation during solubilization and purification

  • Ensuring co-purification of essential cofactors

Functional Analysis Limitations:

  • Distinguishing specific activity from background reactions

  • Recreating appropriate membrane environment for function

  • Limited availability of App-specific antibodies or detection reagents

Solutions:

  • Screen multiple expression constructs with varying N/C-terminal boundaries

  • Explore nanodiscs or liposome reconstitution to provide native-like lipid environment

  • Develop App-specific activity assays with appropriate controls

  • Use advanced biophysical techniques (cryo-EM, NMR) for structural characterization

How does App frdD differ from well-characterized fumarate reductases in model organisms?

While detailed information on App frdD is limited in the current literature, comparative analysis with better-characterized systems like Wolinella succinogenes fumarate reductase suggests several potential differences:

Structural Considerations:

  • W. succinogenes uses a diheme-containing fumarate reductase with specific glutamate residues (Glu-C180) critical for proton transfer coupled to electron transport

  • App frdD may have different heme content or alternative electron transfer pathways

  • Quinol binding sites may show species-specific adaptations related to the bacterial membrane composition

Functional Differences:

  • Catalytic efficiency and substrate specificity may differ based on adaptations to the porcine respiratory environment

  • Regulation patterns likely reflect App-specific metabolic networks

  • Post-translational modifications may differ between organisms

Research comparing conserved residues between W. succinogenes fumarate reductase and App frdD would be valuable for identifying functional analogies and differences.

How do genetic approaches complement biochemical studies of App frdD?

Genetic approaches provide valuable complementary insights to biochemical characterization:

Gene Knockout Studies:

  • Creating frdD deletion mutants to assess growth phenotypes under aerobic vs. anaerobic conditions

  • Evaluating virulence of mutants in cell culture or animal models

  • Complementation studies to confirm gene function

Gene Expression Analysis:

  • Quantifying frdD expression under different growth conditions (oxygen tension, nutrient availability)

  • Measuring expression during infection to determine relevance to pathogenesis

  • Identifying co-regulated genes that may function with frdD

Comparative Genomics:

  • Analyzing frdD conservation across App serotypes

  • Identifying potential horizontal gene transfer events

  • Exploring evolutionary adaptations in respiratory enzymes

The integration of genetic and biochemical approaches provides a more comprehensive understanding of frdD's role in App metabolism and pathogenesis.

How might App frdD contribute to vaccine development against porcine pleuropneumonia?

Fumarate reductase subunit D could potentially contribute to vaccine development strategies in several ways:

As a Vaccine Antigen:

  • If surface-exposed regions exist, they could serve as potential B-cell epitopes

  • Conserved regions across serotypes might provide cross-protection

  • Inclusion in subunit or recombinant vaccines alongside established antigens

For Attenuated Vaccine Strains:

  • Creating frdD mutants with reduced virulence but maintained immunogenicity

  • Developing strains with metabolic attenuation that can colonize but not cause disease

As Expression Systems:

  • Using App expression libraries containing frdD for screening protective antigens, similar to approaches used with other App genes

  • Evaluating immune responses to various App proteins including respiratory enzymes

The potential of App frdD in vaccination strategies would require careful assessment of conservation across serotypes, immunogenicity, and protective efficacy.

What role might App frdD play in antimicrobial resistance and development of new therapies?

Fumarate reductase presents several opportunities for therapeutic intervention:

As an Antimicrobial Target:

  • Developing inhibitors that specifically target App fumarate reductase

  • Creating compounds that disrupt anaerobic respiration without affecting mammalian cells

  • Designing drugs that interfere with membrane integration of frdD

In Understanding Resistance Mechanisms:

  • Investigating how mutations in respiratory enzymes might affect susceptibility to existing antibiotics

  • Exploring metabolic adaptations that occur during antibiotic exposure

  • Identifying potential combination therapies targeting both aerobic and anaerobic metabolism

For Biofilm Disruption:

  • Examining the role of anaerobic respiration in biofilm formation

  • Developing strategies to target metabolically diverse populations within biofilms

Research in this area could potentially lead to novel therapeutic approaches against App infections that are increasingly challenging to treat with conventional antibiotics.

How does the study of App frdD contribute to our understanding of bacterial adaptation to host environments?

Studying App frdD provides insights into bacterial adaptation mechanisms:

Metabolic Flexibility:

  • Understanding how App adjusts its respiratory chain to the microenvironments encountered during infection

  • Elucidating the switch between aerobic and anaerobic metabolism during different infection stages

  • Identifying regulatory mechanisms that control expression of respiratory enzymes

Host-Pathogen Interactions:

  • Determining how respiratory adaptations contribute to persistence in porcine lung tissue

  • Investigating how host immune responses may target or be evaded by App respiratory machinery

  • Exploring potential interactions between App metabolites (like succinate) and host signaling pathways

Evolutionary Considerations:

  • Analyzing how respiratory enzymes have evolved among App serotypes

  • Comparing respiratory systems across the Pasteurellaceae family

  • Identifying unique adaptations that distinguish App from related bacterial pathogens

This research contributes to the broader understanding of bacterial respiratory adaptations to host environments and may inform similar studies in other host-adapted pathogens.

Comparison of Predicted Properties of Fumarate Reductase Across Bacterial Species

SpeciesSubunit CompositionCofactorsElectron DonorKey Functional ResiduesReference System
W. succinogenesFrdA, FrdB, FrdC (diheme)FAD, Fe-S clusters, Heme bMenaquinolGlu-C180 (proton transfer)Most well-characterized
E. coliFrdA, FrdB, FrdC, FrdDFAD, Fe-S clustersMenaquinolHis-232 (FrdB, electron transfer)Common model system
A. pleuropneumoniaeFrdA, FrdB, FrdC, FrdD (predicted)FAD, Fe-S clusters (predicted)UnknownNot determinedLimited data available

Protocol Guidelines for Functional Assays of Fumarate Reductase Activity

Assay TypeReaction ComponentsDetection MethodTypical Activity RangeControls Required
Benzyl Viologen Oxidation50 mM phosphate buffer (pH 7.5), 0.1 mM benzyl viologen, 10 mM fumarate, Na2S2O4 to reduce viologenSpectrophotometric (578 nm)0.5-5 μmol/min/mgNo enzyme, heat-inactivated enzyme
Quinol Oxidation50 mM MOPS (pH 7.0), 50 μM menaquinol (or analog), 10 mM fumarate, 0.05% suitable detergentHPLC analysis or coupled assay0.1-1 μmol/min/mgNo substrate, specific inhibitors
Succinate Production50 mM Tris-HCl (pH 7.5), 10 mM fumarate, electron donor system, anaerobic conditionsEnzymatic assay for succinate or HPLC0.2-2 μmol/min/mgNo enzyme, chemical conversion control

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.