Recombinant Actinobacillus pleuropneumoniae serotype 7 Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for prioritized development.
Synonyms
mscL; APP7_1654; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Target Names
mscL
Target Protein Sequence
MSILKEFREFAVKGNVVDMAVGVIIGGAFGKIVSSLVSDVVMPPIGWLIGGVDFKDLAIE IAPAKEGAEAVMLKYGAFIQNVFDFLIIAIAVFGMVKVINKIKKPAEAAPAEPTAEEKLL TEIRDLLKK
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating intracellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Actinobacillus pleuropneumoniae and why is serotype 7 significant for MscL research?

Actinobacillus pleuropneumoniae is a Gram-negative bacterium that causes porcine contagious pleuropneumonia (PCP), resulting in significant economic losses in the swine industry worldwide. Serotype 7 represents an important variant for study due to its distinctive antigenic profile and cross-reactivity patterns. Specifically, the reference serotype 7 strain (WF83) shows cross-reactivity with serotype 1B but not with other serotypes, while field serotype 7 strains demonstrate broader cross-reactivities with serotypes 1A, 1B, 4, 9, 10, and 11 in various serological tests . These characteristics make serotype 7 particularly valuable for studying membrane proteins like MscL, as the serotype's antigenic heterogeneity provides a diverse experimental background for understanding protein function across strain variations.

How does the MscL channel function in A. pleuropneumoniae compared to other bacterial species?

The Large-conductance mechanosensitive channel (MscL) in A. pleuropneumoniae functions fundamentally as an osmotic pressure regulator, similar to other bacterial species, but with notable distinctions in its contributions to virulence and antimicrobial resistance. Research demonstrates that in A. pleuropneumoniae, MscL plays a significant role in osmotic adaptation, antibiotic resistance, and biofilm formation . Unlike some other bacterial species where MscL deletion substantially impacts survival, A. pleuropneumoniae with deleted mscL genes showed no significant differences in virulence or bacterial loads in vivo compared to wild type strains . This suggests that while the basic mechanosensitive function is conserved, the physiological significance of MscL may be more specifically adapted to environmental niches relevant to A. pleuropneumoniae's pathogenicity in porcine respiratory infections.

What are the structural characteristics of MscL in A. pleuropneumoniae serotype 7?

The MscL protein in A. pleuropneumoniae serotype 7 maintains the conserved transmembrane structure typical of large-conductance mechanosensitive channels, though with species-specific amino acid variations that may account for its functional adaptations. While detailed crystallographic data specifically for A. pleuropneumoniae MscL is still developing, comparative analyses with MscL from other Gram-negative bacteria suggest a pentameric assembly with two transmembrane domains per subunit. A particularly noteworthy characteristic of A. pleuropneumoniae MscL is its role in regulating cell length during osmotic adaptation , suggesting potential structural elements that coordinate with cell wall remodeling machinery. Experimental approaches for structural characterization should include expression of the recombinant protein using vectors like pET15b in E. coli BL21(DE3) cells, followed by protein purification through nickel exchange chromatography .

What are the optimal methods for generating recombinant A. pleuropneumoniae serotype 7 MscL protein?

The most effective protocol for generating recombinant A. pleuropneumoniae serotype 7 MscL protein involves a systematic gene cloning and protein expression approach. Begin by amplifying the mscL gene from genomic DNA of A. pleuropneumoniae serotype 7 using PCR with high-fidelity polymerase and primers designed with appropriate restriction sites. Following the methodology established for outer membrane proteins in A. pleuropneumoniae, the amplified gene should be cloned into a prokaryotic expression vector such as pET15b . Transform the construct into E. coli BL21(DE3) competent cells for protein expression. Induce protein expression with IPTG (typically 0.5-1.0 mM) when bacterial culture reaches mid-log phase (OD600 of 0.6-0.8). Optimize expression conditions by testing various temperatures (16-37°C), IPTG concentrations, and induction times. For purification, use nickel exchange chromatography if a His-tag was incorporated in the construct . Verify protein identity and purity using SDS-PAGE and Western blotting with anti-His antibodies or specific antisera against MscL.

How can researchers effectively construct and verify MscL mutants in A. pleuropneumoniae?

Construction of MscL mutants in A. pleuropneumoniae requires a meticulous transconjugation and counterselection approach. The process begins with designing a transconjugation plasmid containing homologous regions flanking the mscL gene, interrupted by an antibiotic resistance marker. Based on established protocols for A. pleuropneumoniae mutant construction, transform this plasmid into a donor strain such as Escherichia coli 32155 . Mix the donor cells with A. pleuropneumoniae recipient cells and cultivate for approximately 5 hours before plating on selective media containing an appropriate antibiotic such as chloromycetin . Select positive clones (Cm^R) and inoculate them into antibiotic-free liquid medium, followed by pelleting and plating on sucrose-containing media. Sucrose-resistant colonies can be considered potential mutants .

Verification of these mutants requires a multi-faceted approach:

  • PCR confirmation using primers flanking the expected deletion

  • Sequence analysis to confirm precise gene modification

  • Heredity stability testing through multiple passages

  • Functional assays to confirm loss of MscL activity, such as osmotic shock tests

  • Complementation studies to restore wild-type phenotype

This comprehensive verification process ensures that observed phenotypes are specifically attributable to the mscL mutation rather than secondary genomic alterations.

What serological tests are most appropriate for characterizing A. pleuropneumoniae serotype 7 strains expressing recombinant MscL?

For comprehensive characterization of A. pleuropneumoniae serotype 7 strains expressing recombinant MscL, a battery of complementary serological tests should be employed. Based on established methodologies for A. pleuropneumoniae serotyping, researchers should utilize:

Serological TestApplicationSensitivityCross-reactivity Management
Coagglutination (COA)Rapid screeningModerateHigh potential for cross-reactions
Immunodiffusion (ID)Antigen characterizationModerateCan distinguish some cross-reactions
Indirect hemagglutination (IHA)Serotype-specific detectionHighMinimal cross-reactivity detected
Counterimmunoelectrophoresis (CIE)Rapid antigen detectionHighShows cross-reactions with serotypes 1A, 1B, 4, 9, 10, and 11
Western blotConfirmatory testVery highIdentifies serotype-specific capsular and somatic antigens

When evaluating recombinant MscL expression specifically, Western blot analysis using anti-MscL antibodies represents the gold standard confirmation method . This approach is particularly important given that field serotype 7 strains frequently demonstrate cross-reactivities with multiple serotypes in primary serological tests . For definitive characterization of atypical strains, Western blot assay should be used as a confirmatory test to identify both serotype-specific capsular antigens and specific membrane proteins like MscL .

How does MscL contribute to osmotic adaptation in A. pleuropneumoniae serotype 7?

MscL plays a crucial role in osmotic adaptation in A. pleuropneumoniae serotype 7 through distinct mechanisms that affect cellular morphology and solute transport. Osmotic shock assays have demonstrated that MscL specifically increases sodium adaptation by regulating cell length . This morphological regulation represents a unique aspect of MscL function in A. pleuropneumoniae compared to other bacterial species. The channel opens in response to membrane tension changes during hypoosmotic shock, creating a large pore that allows the rapid efflux of cytoplasmic solutes, thereby preventing cell lysis.

To investigate this function experimentally, researchers should:

  • Compare wild-type and mscL deletion mutants under varying osmotic conditions

  • Measure cell length changes using microscopy and image analysis

  • Monitor sodium tolerance through growth curve analysis in media with different NaCl concentrations

  • Quantify solute efflux rates using fluorescent markers or radiolabeled compounds

The sodium adaptation function appears to be a specialized adaptation of A. pleuropneumoniae to its niche as a respiratory pathogen, potentially contributing to its ability to survive in different microenvironments within the porcine respiratory tract during infection.

What is the relationship between MscL and antibiotic resistance in A. pleuropneumoniae?

The relationship between MscL and antibiotic resistance in A. pleuropneumoniae represents a complex and somewhat counterintuitive phenomenon. Research has demonstrated that deletion of the mscL gene decreases the sensitivity of A. pleuropneumoniae to multiple antibiotics . This finding is particularly significant as it contrasts with observations in some other bacterial species where MscL has been implicated in antibiotic uptake.

The mechanism appears to involve:

  • Altered membrane permeability in mscL deletion mutants

  • Possible compensatory changes in expression of other membrane proteins

  • Modified efflux pump activity in the absence of MscL

For experimental investigation of this relationship, researchers should conduct minimum inhibitory concentration (MIC) testing across a panel of antibiotics, comparing wild-type, ΔmscL, and complemented strains. Particular attention should be paid to aminoglycoside antibiotics, as MscL has been reported to participate in aminoglycoside uptake in other bacterial species . Additionally, transcriptomic and proteomic analyses of wild-type versus ΔmscL strains can reveal compensatory mechanisms that may explain the unexpected resistance phenotype.

Does MscL expression correlate with virulence in A. pleuropneumoniae serotype 7 infection models?

Current evidence suggests that MscL expression does not significantly correlate with virulence in A. pleuropneumoniae serotype 7 infection models. In vivo studies using a mouse model demonstrated that the survival rates for wild-type, ΔmscL, complemented ΔmscL, ΔmscS, complemented ΔmscS, and ΔmscL-ΔmscS groups were approximately 20%, 30%, 20%, 20%, 20%, and 20%, respectively, with no statistically significant differences between groups . Similarly, bacterial loads in vivo showed no significant differences among these experimental groups.

This finding is particularly noteworthy because it suggests that despite MscL's importance for osmotic adaptation and antibiotic resistance in vitro, the channel may be dispensable during active infection. This could indicate:

  • Functional redundancy with other mechanosensitive channels or osmotic response systems

  • Limited exposure to osmotic challenges during in vivo infection

  • Different regulatory patterns of mscL expression in vivo versus in vitro

Researchers investigating the relationship between MscL and virulence should consider more sensitive models or alternative infection routes, as well as examining tissue-specific bacterial loads and histopathological changes to capture potentially subtle virulence effects not evident in survival statistics alone.

What are common challenges in expressing recombinant A. pleuropneumoniae MscL and how can they be addressed?

Recombinant expression of A. pleuropneumoniae MscL presents several technical challenges due to its nature as a membrane protein. Common difficulties include poor expression yields, protein misfolding, formation of inclusion bodies, and toxicity to host cells. Based on established protocols for recombinant protein expression from A. pleuropneumoniae, researchers can address these challenges through the following approaches:

  • Poor expression yields:

    • Optimize codon usage for the expression host

    • Test multiple expression vectors (pET15b has been successful for A. pleuropneumoniae proteins)

    • Adjust IPTG concentration and induction temperature (lower temperatures often improve yield of membrane proteins)

    • Consider using specialized E. coli strains designed for membrane protein expression (C41, C43)

  • Protein misfolding and inclusion bodies:

    • Use mild detergents during extraction (n-dodecyl β-D-maltoside or CHAPS)

    • Include osmolytes like glycerol in buffers

    • Attempt refolding from inclusion bodies using gradual dialysis

    • Consider fusion tags that enhance solubility (MBP, SUMO)

  • Host cell toxicity:

    • Use tightly regulated expression systems with minimal leaky expression

    • Reduce growth temperature to 16-20°C after induction

    • Decrease induction time

    • Consider cell-free expression systems for highly toxic proteins

Verification of properly folded protein can be achieved through circular dichroism spectroscopy and functional assays such as liposome swelling tests to confirm mechanosensitive channel activity.

How can researchers address antigenic heterogeneity when studying MscL across different A. pleuropneumoniae serotype 7 field isolates?

Addressing antigenic heterogeneity when studying MscL across different A. pleuropneumoniae serotype 7 field isolates requires a systematic approach to characterization and standardization. This challenge is particularly relevant given that field serotype 7 strains show cross-reactivities with multiple serotypes (1A, 1B, 4, 9, 10, and 11) in several serological tests .

Effective strategies include:

  • Initial strain characterization:

    • Perform comprehensive serotyping using multiple methods (COA, ID, IHA, CIE)

    • Use Western blot as a confirmatory test to identify serotype-specific capsular and somatic antigens

    • Sequence the mscL gene from each isolate to document genetic variability

  • Standardized MscL analysis:

    • Create a reference panel of well-characterized strains including the reference serotype 7 strain (WF83)

    • Employ SDS-PAGE and Western blot analyses with MscL-specific antibodies

    • Consider Tricine SDS-PAGE for improved resolution of membrane proteins

  • Cross-reactivity management:

    • Pre-absorb test sera with cross-reactive strains to improve specificity

    • Develop monoclonal antibodies against conserved MscL epitopes

    • Use recombinant MscL proteins for standardization across experiments

  • Comparative functional studies:

    • Assess MscL function consistently across isolates using identical experimental conditions

    • Correlate sequence variations with functional differences

    • Consider creating chimeric proteins to identify functional domains

This multi-faceted approach acknowledges the inherent variability among field isolates while establishing reliable standards for comparative research.

What strategies can overcome difficulties in assessing MscL functionality in membrane environments?

Assessing MscL functionality in membrane environments presents unique challenges due to the protein's complex mechanosensitive properties and membrane integration. Researchers can employ several advanced strategies to overcome these difficulties:

  • Electrophysiological approaches:

    • Patch-clamp analysis of giant spheroplasts or proteoliposomes containing reconstituted MscL

    • Planar lipid bilayer recordings of purified MscL

    • These methods provide direct measurement of channel activity but require specialized equipment and expertise

  • Fluorescence-based assays:

    • Reconstitute MscL in liposomes containing self-quenching fluorescent dyes

    • Monitor dye release upon osmotic downshock as a measure of channel activity

    • This approach enables high-throughput screening but may lack sensitivity for subtle functional changes

  • In vivo functional assessment:

    • Develop osmotic survival assays comparing wild-type and ΔmscL strains

    • Measure cell length changes in response to sodium stress, as MscL regulates cell length during osmotic adaptation

    • These assays reflect physiological function but may be influenced by compensatory mechanisms

  • Structural dynamics analysis:

    • Employ electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling

    • Use fluorescence resonance energy transfer (FRET) to monitor conformational changes

    • These techniques provide detailed information about channel gating but require extensive protein modification

  • Computational approaches:

    • Molecular dynamics simulations to predict channel behavior in different membrane compositions

    • Homology modeling based on related MscL structures if crystallographic data is unavailable

    • These methods complement experimental data but require validation

Each approach has strengths and limitations, and a combination of methods typically provides the most comprehensive assessment of MscL functionality.

How might MscL be utilized in vaccine development against A. pleuropneumoniae infections?

The potential utilization of MscL in vaccine development against A. pleuropneumoniae infections represents an innovative approach that builds upon existing research on membrane proteins as vaccine candidates. While specific studies on MscL-based vaccines are still emerging, the approach can be informed by research on other outer membrane proteins (OMPs) from A. pleuropneumoniae serotype 7.

A strategic research program for MscL-based vaccine development should include:

  • Immunogenicity assessment:

    • Express recombinant MscL using optimized protocols (similar to those used for OMP expression in pET15b vectors)

    • Evaluate antibody responses in animal models following immunization with purified recombinant MscL

    • Compare cellular and humoral immune responses to those elicited by other A. pleuropneumoniae antigens

  • Protection studies:

    • Conduct challenge experiments in mice and pigs using standardized protocols

    • Compare protection rates with existing data showing that recombinant OMP provides approximately 40% protection in mice challenged with A. pleuropneumoniae serotype 7

    • Evaluate dose-dependent protection and duration of immunity

  • Combinatorial approaches:

    • Develop multivalent vaccines incorporating MscL with other protective antigens

    • Test MscL in combination with adjuvants to enhance immunogenicity

    • Explore prime-boost strategies with different antigen delivery systems

  • Delivery systems optimization:

    • Evaluate liposomal formulations to maintain membrane protein conformation

    • Investigate nanoparticle delivery systems

    • Test mucosal delivery routes relevant to respiratory infection

The comparative advantage of MscL as a vaccine antigen may derive from its conservation across serotypes and its functional importance in bacterial adaptation, potentially limiting escape mutations that might otherwise circumvent vaccine-induced immunity.

What are the implications of MscL-MscS interactions for antimicrobial development targeting A. pleuropneumoniae?

The interplay between MscL and MscS (Small-conductance mechanosensitive channel) in A. pleuropneumoniae offers sophisticated targets for antimicrobial development. Research has shown that while deletion of mscL decreases sensitivity to multiple antibiotics, deletion of mscS has the opposite effect on antibiotic susceptibility . This functional divergence presents a nuanced opportunity for targeted drug development.

Strategic research directions should include:

  • Compound screening approaches:

    • Develop high-throughput assays using liposomes containing reconstituted MscL/MscS

    • Screen for compounds that activate MscL to promote antibiotic uptake

    • Identify inhibitors of compensatory mechanisms that emerge when MscL function is compromised

  • Rational drug design:

    • Target the unique structural elements of A. pleuropneumoniae MscL based on comparative analyses

    • Design compounds that specifically modulate channel gating thresholds

    • Develop drugs that stabilize MscL in an open configuration to compromise bacterial membrane integrity

  • Combination therapy strategies:

    • Evaluate synergistic effects between MscL/MscS modulators and conventional antibiotics

    • Quantify enhancement of aminoglycoside efficacy through MscL activation

    • Assess potential for reducing effective antibiotic concentrations through mechanosensitive channel manipulation

  • Resistance development assessment:

    • Monitor potential resistance mechanisms through long-term exposure studies

    • Characterize genetic adaptations that emerge in response to MscL-targeting compounds

    • Evaluate stability of antimicrobial effects across diverse field isolates

The most promising approach may involve compounds that selectively activate MscL to enhance bacterial antibiotic uptake while simultaneously inhibiting compensatory mechanisms, effectively creating a "sensitization" strategy rather than direct bacterial killing.

How do the genomic and proteomic landscapes surrounding MscL differ across A. pleuropneumoniae serotypes?

Understanding the genomic and proteomic landscapes surrounding MscL across A. pleuropneumoniae serotypes represents a frontier in comparative bacterial physiology. While limited data exists specifically on MscL variation, insights can be extrapolated from studies on antigenic heterogeneity in A. pleuropneumoniae serotype 7 and other serotypes.

Comprehensive investigation should include:

  • Comparative genomic analysis:

    • Conduct whole-genome sequencing of multiple isolates from each serotype

    • Analyze conservation of the mscL gene and its promoter regions

    • Identify genomic islands and mobile genetic elements that may influence mscL expression

    • Examine synteny of genes surrounding mscL to identify conserved operonic structures

  • Transcriptomic profiling:

    • Compare mscL expression levels across serotypes under standardized conditions

    • Identify co-expressed genes that may functionally interact with MscL

    • Map transcriptional responses to osmotic challenges across serotypes

    • Characterize serotype-specific regulatory networks controlling mscL expression

  • Proteomic analysis:

    • Use comparative proteomics to identify serotype-specific post-translational modifications of MscL

    • Map protein-protein interaction networks involving MscL across serotypes

    • Analyze membrane proteome composition in wild-type versus ΔmscL strains

    • Identify compensatory protein expression changes in response to mscL deletion

  • Structure-function correlations:

    • Correlate amino acid sequence variations with functional differences in MscL across serotypes

    • Determine if serotype-specific MscL variants exhibit different gating thresholds

    • Assess whether channel conductance properties vary by serotype

This comprehensive analysis would create a detailed map of how this essential mechanosensitive channel has evolved across the diverse A. pleuropneumoniae serotypes, potentially revealing adaptations to specific host microenvironments or pathogenic lifestyles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.