Recombinant Actinobacillus pleuropneumoniae serotype 7 Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ubiB; APP7_2071; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-544
Protein Length
full length protein
Species
Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Target Names
ubiB
Target Protein Sequence
MTCKNTRRLYQIITTFLRYGIDEIIPDIPLTRHARLGRKALFWVRNQHKDQPFGVRLRLA LQELGPVWIKLGQMLSTRRDLFEPELAEQLALLQDSVEPFDGKSARQIIEQALGGSLETW FDEFDEQALASASIAQVHTAKFNQNQPLVGKDVVIKVIRPDIEPIIKADIALMYRLASWV PRLSNDARRLRATEVVREYEKTLLDELDLTREMANAIRLRNNFENSEMLYVPEMYPDFCH KNVIVMERIYGILVSDVETLKANGTDMKLLAERGVQVFFTQVFRDSFFHADMHAGNIFVN PNHPENPQYIGIDCGIVGTLNQNDKRYLAESFVAFFNRDYRRVALMHVESGWTPADTDID AFEQAFREVCEPIFAKPLSEISFGHVLLNLFNVAREFNMEVQPQLVLLQKTLLYIEGLGR QVYPQLDLWQTAKPFLQNWLNEQVGVKAILRDLKQRAPQFREHFAEFPEAVFNALQQQKQ INFRLDELNKTLQAQGRQKSHNVRSIVSGVIILGVLWRFDDLPLWLSCGTLVTVLLVLLL QRKS
Uniprot No.

Target Background

Function
This protein is likely a kinase regulator of UbiI activity, which is involved in the aerobic biosynthesis of coenzyme Q (ubiquinone).
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Actinobacillus pleuropneumoniae and why is it significant?

Actinobacillus pleuropneumoniae (APP) is the etiological agent of porcine pleuropneumonia, a respiratory disease that causes severe economic losses in pig farming worldwide. The pathogen has been identified in most countries and represents a significant challenge to the swine industry. APP infections can range from peracute to chronic forms, with acute cases characterized by severe respiratory distress and high mortality rates . The significance of APP stems from its widespread distribution, economic impact, and the challenges associated with its control in commercial pig populations where colonization is common .

What is the ubiquinone biosynthesis protein UbiB and its function?

UbiB is a protein required for the first monooxygenase step in Coenzyme Q (CoQ/ubiquinone) biosynthesis. In Escherichia coli, UbiB (formerly known as YigR) is homologous to the aarF gene in Providencia stuartii, both essential for CoQ production . UbiB possesses ATPase activity and is part of a multiprotein complex involved in ubiquinone biosynthesis . It belongs to a predicted protein kinase family of which the Saccharomyces cerevisiae ABC1 gene is the prototypic member . The exact molecular mechanism by which UbiB facilitates the hydroxylation step in ubiquinone synthesis remains under investigation, though its biochemical characterization suggests it may function as a regulatory protein kinase in this pathway .

How do ubiquinone biosynthesis pathways differ in oxygen availability?

Bacteria have evolved two distinct pathways for ubiquinone biosynthesis that function under different oxygen conditions:

Pathway TypeKey ProteinsOxygen RequirementMechanism
O₂-dependentUbiB, UbiF, UbiH, UbiIRequires oxygenUses O₂ as co-substrate for hydroxylation reactions
O₂-independentUbiT, UbiU, UbiVFunctions without oxygenUbiU-UbiV form a heterodimer with 4Fe-4S clusters essential for hydroxylation

The O₂-independent pathway represents an evolutionary adaptation that allows bacteria to synthesize ubiquinone across the entire oxygen range. This adaptation is particularly important for bacteria that colonize environments with fluctuating oxygen levels or gradients . The presence of both pathways in many proteobacteria, including several human pathogens, underscores the importance of ubiquinone biosynthesis for bacterial metabolism and survival in diverse environments .

What animal models are available for Actinobacillus pleuropneumoniae research?

While pigs are the natural host for APP infection, experimental mouse models have been developed that offer several advantages:

ModelAdvantagesLimitationsKey Findings
BALB/c mice with airborne APP1 transmission- Easier experimental operation
- Lower cost
- Abundance of genetic resources
- 60% mortality within 3 days
- Small respiratory tract
- Differences in host tropism
- APP1 enters lung and spreads to other organs
- Causes significant lung damage
- Shows response to ampicillin treatment
Immunization studies with genomic expression library- Allows evaluation of potential vaccine candidates
- Permits challenge with different serotypes
- May not fully replicate pig immune responses- L3 sub-library shows highest antibody and IFN-γ production
- Significantly reduced bacterial recovery from lungs
- Improved survival rates

The recently developed mouse model using airborne transmission of APP represents a significant advancement, allowing for fast and reliable studies of APP infection, pathogenesis, and potential therapeutic approaches . This model successfully demonstrates lung damage similar to that observed in pigs and provides a platform for testing antimicrobial efficacy .

How can recombinant UbiB expression be optimized for functional studies?

Optimizing recombinant UbiB expression requires consideration of several factors:

  • Expression System Selection: E. coli systems are commonly used, but the choice between cytoplasmic expression and membrane-associated expression should be based on the protein's native localization.

  • Construct Design: When designing expression constructs for UbiB, consideration must be given to:

    • Inclusion of proper affinity tags (His-tag, GST) for purification

    • Codon optimization for the expression host

    • Signal sequences if membrane association is important for function

    • Potential fusion partners to enhance solubility

  • Expression Conditions: Optimization of induction parameters (temperature, inducer concentration, duration) is critical as UbiB is likely membrane-associated and may form inclusion bodies at high expression levels.

  • Purification Strategy: Given UbiB's predicted association with membrane complexes, detergent-based extraction methods followed by affinity chromatography are typically required.

  • Functional Verification: Activity assays should be designed to assess ATPase activity and the protein's ability to complement ubiB mutants in CoQ biosynthesis pathways.

How does UbiB contribute to bacterial pathogenesis and virulence?

The relationship between UbiB function and bacterial pathogenesis operates through several mechanisms:

What serological methods are effective for detecting Actinobacillus pleuropneumoniae infections?

Detection of APP infections presents challenges due to cross-reactivity between antibodies against different toxins. The following serological approaches have proven effective:

MethodTargetAdvantagesLimitations
ApxIV-based immunoblotN-terminal part of ApxIV toxin- Highly specific (ApxIV produced only during infection)
- Detects all 15 serotypes
- Detection by 2-3 weeks post-infection
- Not useful for early detection
- Requires immunoblot technique
ApxIV-based indirect ELISAPurified recombinant N-terminal ApxIV- Higher throughput than immunoblot
- Quantitative results
- Better sensitivity
- Similar timeframe limitations
Conventional antibody tests targeting ApxI, ApxII, ApxIIIMajor RTX toxins- Earlier detection possible- Cross-reactivity with antibodies from non-APP Actinobacillus species (A. rossii, A. suis)

The development of ApxIV-based serological methods represents a significant advancement in specifically detecting APP infections, as antibodies against this toxin are only found in pigs infected with APP, not in those exposed to other Actinobacillus species .

What molecular approaches can be used to study UbiB function in Actinobacillus pleuropneumoniae?

Several molecular approaches can be employed to investigate UbiB function in APP:

  • Gene Disruption Techniques:

    • Homologous recombination-based knockout

    • Transposon mutagenesis

    • CRISPR-Cas9 genome editing

  • Functional Complementation:

    • Expression of APP ubiB in E. coli ubiB mutants to confirm functional conservation

    • Cross-complementation with ubiB homologs from other species

  • Protein-Protein Interaction Studies:

    • Bacterial two-hybrid systems

    • Co-immunoprecipitation with potential binding partners

    • Crosslinking studies to identify complex components

  • Biochemical Characterization:

    • ATPase activity assays

    • Kinase activity assays (based on homology to the protein kinase family)

    • Substrate binding studies

  • Structural Biology Approaches:

    • X-ray crystallography or cryo-EM to determine protein structure

    • Molecular dynamics simulations to predict functional domains

How should contradictory results in UbiB functional studies be approached?

When facing contradictory results in UbiB research, consider these methodological approaches:

  • Strain and Serotype Considerations: APP has 15 serotypes with potential genetic variability. Studies comparing UbiB function across different strains should:

    • Sequence verify the gene from each strain used

    • Compare protein sequence homology between strains

    • Consider serotype-specific adaptations that might influence UbiB function

  • Experimental Condition Variations:

    • Oxygen levels significantly impact ubiquinone biosynthesis pathways

    • Growth phase affects metabolic requirements

    • Media composition can influence gene expression

    • Temperature variations may affect protein folding and function

  • Technical Approach Differences:

    • In vitro vs. in vivo studies may yield different results

    • Purified protein studies vs. whole-cell assays measure different aspects of function

    • Host factors in infection models may influence results

  • Data Integration Framework:

    • Develop a unified model incorporating conditional dependencies

    • Use meta-analysis techniques to identify consistent findings across studies

    • Apply systems biology approaches to place contradictory results in broader context

What bioinformatic tools are recommended for analyzing UbiB sequence and function?

For comprehensive UbiB analysis, researchers should employ the following bioinformatic approaches:

Analysis TypeRecommended ToolsApplication
Sequence AnalysisBLAST, Clustal Omega, MUSCLEIdentify homologs, conserved domains, and evolutionary relationships
Structural PredictionAlphaFold2, I-TASSER, SWISS-MODELGenerate 3D structural models for functional inference
Functional Domain IdentificationInterPro, Pfam, SMARTIdentify functional domains, particularly kinase-related motifs
Prokaryotic Promoter AnalysisBPROM, PePPERAnalyze expression regulation
Protein-Protein Interaction PredictionSTRING, STITCHPredict interaction partners in ubiquinone biosynthesis
Metabolic Pathway ModelingKEGG, BioCyc, MetaCycPlace UbiB in the context of ubiquinone biosynthesis pathways
Comparative GenomicsOrthoMCL, GET_HOMOLOGUESCompare UbiB across bacterial species and strains

These tools should be used in combination to develop comprehensive models of UbiB function, potentially revealing insights into its role in both ubiquinone biosynthesis and bacterial pathogenesis.

How can UbiB be targeted for antimicrobial development?

UbiB represents a potential target for novel antimicrobial development based on several characteristics:

  • Essential Metabolic Function: UbiB's role in ubiquinone biosynthesis makes it essential for respiratory metabolism in many bacteria, including important pathogens.

  • Target Specificity Considerations:

    • UbiB belongs to a protein family with members in both prokaryotes and eukaryotes

    • Structural and functional differences between bacterial and host homologs must be exploited

    • Inhibitors should be designed to target bacterial-specific structural features

  • Potential Targeting Strategies:

    • ATPase activity inhibition

    • Disruption of protein-protein interactions within the biosynthetic complex

    • Substrate or cofactor competitive binding

  • Experimental Evidence Supporting Targeting:

    • Ampicillin has been shown effective against APP infections in mouse models

    • Understanding metabolic dependencies could reveal synergistic drug combinations

  • Resistance Development Risk Assessment:

    • Presence of alternative O₂-independent pathways may provide escape mechanisms

    • Essential nature of the target may reduce resistance development through mutations

What approaches show promise for vaccination against Actinobacillus pleuropneumoniae?

Research on APP vaccination has explored several promising approaches:

Vaccine ApproachKey FeaturesEfficacy DataAdvantages/Limitations
Genomic Expression LibraryDNA vaccine approach using plasmid sub-librariesSub-library L3 showed highest antibody/IFN-γ production and survival rate against challenge + Targets multiple antigens
- Complex production
ApxIV-based VaccinesFocuses on the serotype-independent ApxIV toxinNot fully detailed in search results+ Universal across serotypes
- Only produced during infection
Cross-protection StrategiesImmunization with one serotype to protect against othersSerotype 7 library showed protection against serotype 1 challenge + Broader protection
- Variable cross-protection efficiency

Recent research using a genomic expression library of APP serotype 7 has shown promising results in mice. When challenged with APP serotype 1, mice immunized with a specific sub-library (L3) demonstrated elevated antibody and IFN-γ production, significantly reduced bacterial recovery from lungs, and improved survival rates . This approach suggests that targeting multiple antigens simultaneously may provide more effective protection than single-antigen approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.