Recombinant Actinobacillus pleuropneumoniae serotype 7 Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Actinobacillus pleuropneumoniae Serotype 7 Prolipoprotein Diacylglyceryl Transferase (lgt)

Recombinant Actinobacillus pleuropneumoniae serotype 7 Prolipoprotein diacylglyceryl transferase (lgt) is a recombinant protein derived from the bacterium Actinobacillus pleuropneumoniae, specifically serotype 7. This enzyme plays a crucial role in the bacterial cell membrane by facilitating the transfer of diacylglyceryl groups to prolipoproteins, which are essential for bacterial membrane integrity and function.

Characteristics of Recombinant Actinobacillus pleuropneumoniae Serotype 7 Prolipoprotein Diacylglyceryl Transferase (lgt)

  • Source and Production: This recombinant protein is produced in both E. coli and yeast systems, depending on the manufacturer .

  • Purity and Length: It is available with a purity of more than 85% as determined by SDS-PAGE and is a partial protein .

  • Storage and Stability: The shelf life varies based on storage conditions; liquid forms typically last 6 months at -20°C/-80°C, while lyophilized forms can last up to 12 months under similar conditions .

Biological Function

Prolipoprotein diacylglyceryl transferase (lgt) is involved in the modification of prolipoproteins by attaching diacylglyceryl groups. This modification is crucial for the proper anchoring of these proteins in the bacterial cell membrane, affecting bacterial viability and virulence.

Data Table: Characteristics of Recombinant Actinobacillus pleuropneumoniae Serotype 7 Prolipoprotein Diacylglyceryl Transferase (lgt)

CharacteristicsDescription
SourceE. coli or Yeast
Purity>85% (SDS-PAGE)
Protein LengthPartial
Storage Conditions-20°C/-80°C
Shelf Life (Liquid)6 months
Shelf Life (Lyophilized)12 months
Tag TypeDetermined during manufacturing
Protein FunctionDiacylglyceryl transfer to prolipoproteins

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
lgt; APP7_1982; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Target Names
lgt
Target Protein Sequence
MNEQFIQFPQIDPIIFSIGPIALRWYGLMYLIGFGFAYWLGMRRAKNSNGVWTTEQVDQL IYTCFWGVILGGRIGDVFFYNFDRLLQDPMFLFRIWEGGMSFHGGLIGVIVAMIWVSFRQ KRSFWNTADFIAPLIPFGLGMGRIGNFINDELWGRITDVPWAVLFPSGGYLPRHPSQLYE FFLEGVVLFFILNWFIKKPRPAGSVAGLFLIGYGVFRFLVEYVRDIDPNVNTVDDLITRG QLLSLPMIIGGLAIMIWAYSRKKA
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the N-terminal cysteine sulfhydryl group of a prolipoprotein. This is the initial step in mature lipoprotein formation.

Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Actinobacillus pleuropneumoniae and its clinical significance?

Actinobacillus pleuropneumoniae is an important veterinary pathogen that causes porcine pleuropneumonia, a severe respiratory disease in swine . The bacterium is responsible for significant economic losses in the swine industry due to mortality, reduced growth rates, and increased treatment costs. A. pleuropneumoniae has multiple serotypes (including serotype 7), which display varying degrees of virulence and antigenic properties. Understanding this pathogen is crucial for developing effective control strategies, including vaccines and diagnostic tools for porcine respiratory diseases.

What are lipoproteins in A. pleuropneumoniae and why are they significant?

Lipoproteins in bacterial pathogens like A. pleuropneumoniae play pleiotropic roles in the infection process . They function in various cellular processes including nutrient acquisition, stress response, adhesion, and immune evasion. Many bacterial lipoproteins are antigenic and immunoprotective, making them promising candidates for vaccine development and diagnostic markers . Characterizing these lipoproteins is therefore a strategic approach for identifying novel vaccine candidates or diagnostic tools for A. pleuropneumoniae infections.

What is Prolipoprotein diacylglyceryl transferase (lgt) and its role in A. pleuropneumoniae?

Prolipoprotein diacylglyceryl transferase (lgt) is a key enzyme in the biosynthesis pathway of bacterial lipoproteins. It catalyzes the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the conserved cysteine residue in the lipobox motif of prolipoproteins, which is the first and essential step in lipoprotein maturation. In A. pleuropneumoniae, lgt is crucial for the proper processing and functioning of numerous lipoproteins that contribute to bacterial virulence, cell envelope integrity, and interaction with the host immune system.

What are the recommended methods for cloning and expressing recombinant A. pleuropneumoniae proteins?

For successful expression of recombinant A. pleuropneumoniae proteins, the following methodological approach is recommended:

  • DNA extraction from A. pleuropneumoniae culture using a genomic DNA preparation kit

  • Amplification of the target gene (e.g., lgt) by PCR with specific primers

  • Ligation into an A/T cloning vector (such as pMD18-T) for sequence verification

  • Subcloning into a prokaryotic expression vector (e.g., pGEX-KG) to generate an expression plasmid with a fusion tag (like GST)

  • Transformation into an expression host (E. coli BL21(DE3))

  • Induction of protein expression using IPTG (typically 1 mM)

  • Cell lysis and protein purification

This approach has been successfully applied to numerous A. pleuropneumoniae lipoproteins, with an 81% success rate reported for expression of various lipoprotein genes .

What purification strategies yield the highest purity for recombinant A. pleuropneumoniae proteins?

For optimal purification of recombinant A. pleuropneumoniae proteins, affinity chromatography is the method of choice. Specifically, for GST-fusion proteins, glutathione-Sepharose 4B affinity chromatography is highly effective . The purification workflow typically involves:

  • Cell lysis by sonication or other mechanical disruption methods

  • Clarification of lysate by centrifugation to remove cellular debris

  • Loading the supernatant onto an equilibrated glutathione-Sepharose column

  • Washing to remove non-specifically bound proteins

  • Elution of the target protein with reduced glutathione

  • Optional: Tag removal using site-specific proteases if required for downstream applications

For recombinant A. pleuropneumoniae proteins, this approach can yield preparations of sufficient purity for immunological studies and functional characterization.

What expression systems provide optimal solubility for recombinant A. pleuropneumoniae lipoproteins?

Studies with A. pleuropneumoniae lipoproteins have shown that E. coli expression systems can effectively produce soluble recombinant proteins. In a comprehensive study of 58 A. pleuropneumoniae lipoproteins, 47 (81%) were successfully expressed in E. coli, with 37 (79%) of these being soluble and 10 (21%) insoluble . This indicates that E. coli is generally a suitable host for A. pleuropneumoniae lipoprotein expression.

To optimize solubility:

  • Consider using fusion tags like GST that enhance solubility

  • Optimize induction conditions (temperature, IPTG concentration, induction time)

  • Use specialized E. coli strains designed for enhanced soluble expression

  • Consider co-expression with chaperones for challenging proteins

The table below summarizes expression outcomes for A. pleuropneumoniae lipoproteins:

Expression OutcomeNumber of ProteinsPercentage
Successfully expressed47/5881%
Soluble proteins37/4779%
Insoluble proteins10/4721%

What are the structural characteristics of Prolipoprotein diacylglyceryl transferase (lgt) in A. pleuropneumoniae?

Prolipoprotein diacylglyceryl transferase (lgt) in A. pleuropneumoniae is an integral membrane protein characterized by multiple transmembrane domains. While no specific structural data for A. pleuropneumoniae lgt is available in the provided search results, lgt proteins across bacterial species typically contain 7-8 transmembrane segments with both N and C termini located in the cytoplasm. The active site contains conserved amino acid residues essential for catalytic activity, positioned to interact with both the phosphatidylglycerol donor and the prolipoprotein substrate.

The enzyme recognizes a specific sequence motif in prolipoproteins known as the lipobox, typically containing a conserved cysteine residue that becomes the target for diacylglyceryl modification. Understanding these structural features is crucial for studies involving site-directed mutagenesis, inhibitor design, and functional characterization.

How does lgt interact with other components of the lipoprotein biosynthesis pathway in A. pleuropneumoniae?

In the lipoprotein biosynthesis pathway, lgt acts as the first enzyme in a series of three sequential modifications. After lgt transfers the diacylglyceryl moiety to the cysteine residue of the prolipoprotein, signal peptidase II (LspA) cleaves the signal peptide, and apolipoprotein N-acyltransferase (Lnt) adds a third fatty acid to the N-terminus of the mature lipoprotein.

These three enzymes (Lgt, LspA, and Lnt) form a coordinated pathway that ensures proper processing of lipoproteins. Disruption of lgt function would prevent subsequent processing steps, leading to accumulation of unmodified prolipoproteins and potential reduction in bacterial virulence, as properly processed lipoproteins are critical for multiple virulence-associated functions.

What functional assays are available to assess the enzymatic activity of recombinant lgt?

Several functional assays can be employed to assess the enzymatic activity of recombinant lgt:

  • Radiolabeled lipid incorporation assay: Measures the transfer of radiolabeled glycerol or fatty acids from phosphatidylglycerol to prolipoprotein substrates.

  • Mass spectrometry-based assays: Detects the mass shift in substrate proteins after diacylglyceryl modification.

  • Fluorescence-based assays: Utilizes fluorescently labeled substrate analogs to monitor the reaction progress.

  • Complementation assays: Tests the ability of recombinant lgt to restore lipoprotein processing in lgt-deficient bacterial strains.

  • In vitro reconstitution: Reconstructs the enzymatic reaction using purified components in artificial membrane systems.

When performing these assays, it's important to include appropriate controls, such as known active and inactive (mutated) versions of the enzyme, to validate the assay system.

How can recombinant A. pleuropneumoniae lipoproteins be evaluated for immunogenicity?

Evaluation of immunogenicity for recombinant A. pleuropneumoniae lipoproteins involves a systematic approach:

  • Western blotting screening: Test recombinant proteins against heterologous antisera (e.g., from different serotypes) to identify cross-reactive antigens . In a study with A. pleuropneumoniae lipoproteins, 31 of 37 tested soluble proteins yielded positive results in western blotting against heterologous antiserum .

  • Animal immunization studies: Immunize experimental animals (mice initially, followed by target species - pigs) with purified recombinant proteins and measure:

    • Antibody responses using ELISA to determine IgG titers

    • Cell-mediated immune responses via cytokine profiling or cellular assays

    • Protection against challenge with virulent A. pleuropneumoniae strains

  • Passive immunization assays: Transfer serum from immunized animals to naïve recipients and challenge with virulent bacteria to assess the protective capacity of antibodies alone .

This multi-step approach allows researchers to identify proteins with strong immunogenicity and protective potential.

What is the cross-protective potential of serotype 7-derived recombinant proteins against heterologous A. pleuropneumoniae strains?

Recombinant proteins derived from A. pleuropneumoniae serotype 7 may offer cross-protection against heterologous serotypes due to the conservation of certain antigens across serotypes. This cross-protective potential can be assessed through:

  • Sequence conservation analysis: Comparing protein sequences across serotypes to identify highly conserved regions that might elicit cross-protective responses.

  • Serological cross-reactivity: Testing the ability of antibodies raised against serotype 7 proteins to recognize proteins from other serotypes. Studies have shown that serotype 7 strains display cross-reactivity with multiple serotypes including 1A, 1B, 4, 9, 10, and 11 in various serological tests .

  • Heterologous challenge studies: Immunizing animals with serotype 7-derived proteins and challenging with heterologous serotypes. For example, in a study with A. pleuropneumoniae lipoproteins (though not specifically from serotype 7), three proteins (APJL_0922, APJL_1380, and APJL_1976) generated efficient immunoprotection in mice against lethal heterologous challenge with A. pleuropneumoniae 4074 (serovar 1) .

The antigenic heterogeneity of serotype 7 strains suggests potential for cross-protective vaccine development, particularly if conserved lipoproteins like lgt are targeted.

What adjuvants are most effective for enhancing immune responses to A. pleuropneumoniae recombinant proteins?

While the search results don't specifically mention adjuvants used with A. pleuropneumoniae recombinant proteins, the following adjuvants have generally proven effective for bacterial subunit vaccines:

  • Aluminum-based adjuvants (alum): These are commonly used and generally safe, though they primarily stimulate humoral immunity rather than cell-mediated responses.

  • Oil-in-water emulsions: Adjuvants like Freund's complete/incomplete adjuvant (for experimental animals) or Montanide ISA series (for veterinary vaccines) can elicit strong and persistent antibody responses.

  • Toll-like receptor (TLR) agonists: These include monophosphoryl lipid A (MPLA), CpG oligodeoxynucleotides, and other pathogen-associated molecular patterns that enhance both humoral and cell-mediated immunity.

  • Saponin-based adjuvants: QuilA and its purified fractions (e.g., QS-21) or ISCOM (immune stimulating complexes) formulations can elicit robust antibody and T-cell responses.

Selection of the optimal adjuvant should be based on the desired immune response profile, safety considerations, and compatibility with the specific recombinant protein.

How can gene knockout or silencing of lgt be utilized to study lipoprotein function in A. pleuropneumoniae?

Gene knockout or silencing of lgt in A. pleuropneumoniae can serve as a powerful tool to:

  • Create a lipoprotein processing-deficient strain: Since lgt catalyzes the first step in lipoprotein maturation, its inactivation would affect all lipoproteins, allowing researchers to study the collective importance of properly processed lipoproteins.

  • Investigate virulence attenuation: Comparing the virulence of wild-type and lgt-deficient strains in animal models can reveal the contribution of mature lipoproteins to pathogenesis.

  • Identify lipoprotein-dependent phenotypes: Examining changes in membrane integrity, stress resistance, antibiotic susceptibility, biofilm formation, and other phenotypes in lgt mutants.

  • Perform complementation studies: Reintroducing wild-type or mutated versions of lgt to assess which domains/residues are critical for function.

  • Develop potential live attenuated vaccines: If lgt mutants show significant attenuation but can still colonize temporarily, they might serve as vaccine candidates.

Methodological considerations include using inducible or conditional knockout systems if lgt is essential for viability, and confirming the knockout effect by analyzing the lipoprotein profile using proteomics approaches.

What proteomic approaches can identify the complete lipoprotein repertoire in A. pleuropneumoniae serotype 7?

Several proteomic approaches can be employed to comprehensively identify the lipoprotein repertoire in A. pleuropneumoniae serotype 7:

  • Bioinformatic prediction followed by experimental validation: As described in the search results, initial identification of 60 putative lipoproteins was performed using bioinformatic prediction , followed by experimental characterization.

  • Membrane fractionation and selective labeling: Techniques such as Triton X-114 phase separation can enrich for lipoproteins, followed by specific labeling of lipid-modified proteins.

  • Mass spectrometry-based approaches:

    • Global lipoprotein profiling using LC-MS/MS after membrane enrichment

    • Identification of lipid-modified peptides through specialized MS techniques

    • Quantitative proteomics to compare lipoprotein expression under different conditions

  • Metabolic labeling with lipid analogs: Incorporation of clickable or affinity-tagged lipid analogs into bacterial lipoproteins, enabling selective enrichment and identification.

Each approach has its strengths and limitations, and a combination of methods would provide the most comprehensive analysis of the lipoprotein repertoire.

How does environmental modulation affect lgt expression and activity in A. pleuropneumoniae?

While the search results don't directly address environmental regulation of lgt in A. pleuropneumoniae, general principles of bacterial gene regulation suggest several potential factors that might influence lgt expression and activity:

  • Growth phase-dependent regulation: Expression levels of lgt might vary between exponential and stationary growth phases as the demand for new lipoproteins changes.

  • Nutrient availability: Limitation of specific nutrients might alter lgt expression in response to changing membrane composition or lipoprotein requirements.

  • Environmental stress conditions:

    • Temperature shifts (reflecting transition from environment to host)

    • pH changes (relevant during infection of different host tissues)

    • Oxidative stress (encountered during host immune response)

    • Iron limitation (a common host defense mechanism)

  • Host-derived signals: Molecules encountered during infection might trigger changes in lgt expression as part of adaptive responses.

  • Biofilm formation: Expression patterns might differ between planktonic and biofilm growth states.

Research methodologies to investigate these effects would include qRT-PCR for transcriptional analysis, reporter gene fusions to monitor expression in different conditions, and activity assays to assess functional changes in the enzyme.

How can recombinant lgt be utilized in serological diagnostics for A. pleuropneumoniae infections?

Recombinant lgt from A. pleuropneumoniae serotype 7 could be valuable in serological diagnostics through several approaches:

  • ELISA-based detection: Development of indirect ELISA systems using purified recombinant lgt to detect anti-lgt antibodies in porcine serum samples. If lgt is conserved across serotypes and immunogenic during natural infection, it could serve as a pan-serotype diagnostic marker.

  • Multiplexed serological assays: Incorporating lgt alongside other recombinant A. pleuropneumoniae antigens in protein microarrays or multiplex bead-based assays to improve diagnostic sensitivity and specificity.

  • Lateral flow assays: Creating rapid, field-deployable immunochromatographic tests using recombinant lgt for point-of-care diagnosis in swine herds.

  • Western blot confirmation: Using recombinant lgt in immunoblots as a confirmatory test for samples with ambiguous ELISA results, similar to the Western blot approach mentioned for serotyping atypical strains .

The utility of lgt for these applications would depend on its conservation across serotypes, immunogenicity during natural infection, and the absence of cross-reactivity with other porcine pathogens.

What are the challenges in differentiating serotype 7 from other A. pleuropneumoniae serotypes in diagnostic settings?

Differentiating A. pleuropneumoniae serotype 7 from other serotypes presents several challenges in diagnostic settings:

  • Antigenic cross-reactivity: Serotype 7 strains show cross-reactivity with multiple other serotypes in various serological tests. The reference serotype 7 strain (WF83) demonstrates cross-reactivity with serotype 1B, while field strains show even broader cross-reactivity with serotypes 1A, 1B, 4, 9, 10, and 11 .

  • Test-dependent variation: Different serological tests yield varying results. For example, cross-reactivity observed in coagglutination (COA), immunodiffusion (ID), and counterimmunoelectrophoresis (CIE) tests may not be seen in indirect hemagglutination (IHA) tests .

  • Atypical strains: Some field isolates of apparent serotype 7 can be challenging to classify. Two field strains (90-3182 and 86-1411) initially classified as serotype 7 required further characterization by SDS-PAGE, Western blot, and Tricine SDS-PAGE assays, ultimately being identified as serotypes 1 and 7, respectively .

  • Recommended approach: For accurate serotyping of atypical strains, Western blot assay is suggested as a confirmatory test to identify serotype-specific capsular and somatic antigens .

What molecular techniques can complement serological methods for A. pleuropneumoniae serotype identification?

Several molecular techniques can complement serological methods for more accurate A. pleuropneumoniae serotype identification:

  • PCR-based serotyping: Development of serotype-specific PCR assays targeting unique regions in capsular biosynthesis genes or other serotype-specific genetic markers.

  • Multiplex PCR: Simultaneous detection of multiple serotype-specific targets in a single reaction, allowing rapid differentiation between serotypes.

  • Real-time PCR with melting curve analysis: Identification of serotypes based on characteristic melting temperatures of amplicons.

  • Whole genome sequencing (WGS): Comprehensive analysis of the bacterial genome to identify serotype-determining genetic elements and detect potential novel variants.

  • MALDI-TOF MS: Mass spectrometry profiles can potentially distinguish between serotypes based on characteristic protein patterns.

  • Next-generation sequencing of capsular biosynthesis loci: Targeted sequencing of regions responsible for capsular polysaccharide synthesis to determine serotype.

These molecular approaches, when used in conjunction with traditional serological methods such as Western blot analysis , can provide more definitive serotype identification, particularly for atypical strains that show cross-reactivity in serological tests.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.