Recombinant Actinobacillus pleuropneumoniae serotype 7 Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

Protease HtpX is a zinc-dependent metalloprotease encoded by the htpX gene (UniProt ID: B3H1S0) in A. pleuropneumoniae serotype 7 (strain AP76) . Key features include:

PropertyDetails
Gene NamehtpX
Protein LengthPartial sequence (1–289 amino acids)
Molecular Weight~32 kDa (predicted)
Enzyme ClassificationEC 3.4.24.- (metalloprotease)
Alternative NamesHeat shock protein HtpX
TagDetermined during production (commonly His-tag)
Expression SystemEscherichia coli

The protein contains a conserved zinc-binding motif critical for proteolytic activity, which is implicated in stress response and pathogenicity .

Recombinant Production and Purification

The protein is produced in E. coli using codon-optimized expression vectors. Key production parameters include:

ParameterSpecification
Purity>85% (SDS-PAGE)
Storage BufferTris-based buffer with 50% glycerol
Reconstitution0.1–1.0 mg/mL in deionized water, supplemented with 5–50% glycerol
Shelf Life12 months (lyophilized) at -20°C/-80°C

Recombinant HtpX is typically lyophilized to enhance stability, with repeated freeze-thaw cycles discouraged .

Diagnostic Use

  • ELISA Development: Utilized as an antigen to detect A. pleuropneumoniae-specific antibodies .

  • Protease Activity Assays: Screening for inhibitors targeting bacterial proteases .

Vaccine Development

Although HtpX itself is not yet a vaccine candidate, recombinant proteins like ApxII and Oml from A. pleuropneumoniae have been successfully produced in E. coli for subunit vaccines . HtpX could serve as a supplementary antigen in multivalent formulations.

Comparative Analysis with Other Serotypes

FeatureSerotype 7 (HtpX)Serotype 3 (HtpX)
UniProt IDB3H1S0 B0BPX8
Protein LengthPartial (1–289 aa) Full-length (1–289 aa)
Expression TagVariable (determined during production) His-tag

Challenges and Future Directions

  • Functional Studies: Mechanistic insights into HtpX’s role in stress response and virulence are needed.

  • Optimized Production: Adoption of bicistronic T7 expression systems could enhance yields, as demonstrated for other A. pleuropneumoniae antigens .

  • Cross-Protection Trials: Evaluation of HtpX’s immunogenicity in combination with Apx and Oml antigens .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
htpX; APP7_1095; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Target Names
htpX
Target Protein Sequence
MAKRIVLFLLTNLAITFVLGIVLNIIFQVTGIQGGSTGGILVMSLVFGFAGSLISLFMSK SMALRSVGAEVIQQPRNHAEQWLFDTVQRQSQQANIPMPDIAIYHSADVNAFATGATKNN SLVAVSTGLLDNMTEDEAEAVVAHEIAHIANGDMVTMTLLQGVLNTFVIFLSRIISTAAS SGKDENGNATQNTLVFWIVDIALQMIFGVIATMIAMWFSRYREYRADAGSAQLVGKEKMI AALQRLQHVHEPQEMQGSLAAFMINGARSKELFMSHPPLEKRIEALRNL
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Protease HtpX and what is its functional classification in Actinobacillus pleuropneumoniae?

Protease HtpX in Actinobacillus pleuropneumoniae is classified as an EC 3.4.24.- metalloprotease and is alternatively known as Heat shock protein HtpX. The protein is encoded by the htpX gene (locus tag APP7_1095 in serotype 7 strain AP76) and consists of 289 amino acids . As a heat shock protein, HtpX is likely involved in the cellular stress response mechanisms, particularly in response to elevated temperatures.

The functional analysis of HtpX suggests it plays a role in protein quality control within the cell membrane, potentially degrading misfolded or damaged membrane proteins. Its classification within the metalloprotease family indicates its proteolytic mechanism relies on a metal ion, typically zinc, for catalytic activity. While specific substrates for A. pleuropneumoniae HtpX have not been fully characterized, research on homologous proteins in other bacteria suggests it may target membrane proteins that become misfolded during stress conditions .

Methodologically, to study HtpX function, researchers typically use either gene knockout experiments followed by phenotypic analysis under stress conditions, or in vitro proteolytic assays using the recombinant protein against potential substrate proteins.

What are the optimal storage and handling conditions for recombinant HtpX protein?

Proper storage and handling of recombinant Actinobacillus pleuropneumoniae HtpX protein is critical for maintaining its structural integrity and enzymatic activity. Based on manufacturer recommendations and protein biochemistry principles, the following protocol should be followed:

Storage Conditions:

  • Store lyophilized protein at -20°C to -80°C upon receipt

  • For reconstituted protein, store at -20°C for extended storage periods

  • Working aliquots can be maintained at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein activity

Reconstitution Protocol:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For optimal buffer conditions, use Tris-based buffer with 50% glycerol, optimized for this specific protein

  • Prepare small working aliquots to minimize freeze-thaw cycles

Stability Considerations:

  • For experiments requiring prolonged protein exposure to ambient temperatures, thermal stability can be enhanced by adding stabilizing agents such as glycerol (final concentration 10-20%)

  • Monitor protein activity regularly if stored for extended periods

  • If using for enzymatic assays, positive controls should be included to verify protein activity

These handling protocols ensure maximum retention of HtpX protein structure and activity for research applications, particularly important for enzymatic assays and structural studies where protein integrity is critical.

What are the recommended methodologies for assessing HtpX proteolytic activity in laboratory settings?

Assessment of HtpX proteolytic activity requires careful experimental design to account for its membrane-associated nature and specific substrate preferences. The following methodological approaches are recommended:

In vitro Proteolytic Assays:

  • Fluorogenic peptide substrate assay:

    • Use custom fluorogenic peptides containing FRET pairs

    • Monitor cleavage through increased fluorescence as FRET is disrupted

    • Include controls with metal chelators (e.g., EDTA) to confirm metalloprotease activity

  • Membrane protein substrate assay:

    • Incorporate potential substrate proteins into liposomes or nanodiscs

    • Incubate with purified HtpX

    • Analyze degradation products by SDS-PAGE and Western blotting

Assessment Parameters:

  • Optimal conditions: pH 7.0-8.0, 37°C (or 42°C to mimic heat stress)

  • Include zinc or other divalent cations (1-5 mM) in reaction buffer

  • Monitor time-dependent substrate degradation (0, 15, 30, 60, 120 minutes)

Data Analysis and Quantification:

  • For fluorogenic assays, calculate initial velocity from the linear portion of the fluorescence vs. time plot

  • For protein substrate assays, use densitometry to quantify substrate disappearance

  • Plot enzyme kinetics data using Michaelis-Menten or Lineweaver-Burk plots to derive Km and Vmax

Additional Consideration:
When using recombinant HtpX containing affinity tags (e.g., His-tag), conduct parallel experiments with tag-cleaved protein to assess potential tag interference with proteolytic activity .

This comprehensive approach enables precise characterization of HtpX proteolytic activity, substrate specificity, and reaction kinetics, providing valuable insights into its biochemical properties and potential physiological roles.

How can researchers generate and validate gene knockout models for studying HtpX function in A. pleuropneumoniae?

Creating and validating htpX gene knockout models in Actinobacillus pleuropneumoniae requires specialized methodologies due to the challenging nature of genetic manipulation in this pathogen. The following research protocol outlines a comprehensive approach:

Generation of htpX Knockout Mutants:

  • Homologous recombination method:

    • Construct a suicide vector containing:

      • Upstream (500-1000 bp) and downstream (500-1000 bp) flanking regions of htpX

      • Antibiotic resistance cassette (e.g., kanamycin resistance gene)

    • Transform into A. pleuropneumoniae using electroporation

    • Select transformants on appropriate antibiotic-containing media

    • Confirm gene replacement by PCR and sequencing

  • CRISPR-Cas9 approach:

    • Design sgRNAs targeting htpX coding sequence

    • Construct a plasmid containing Cas9, sgRNA, and homology-directed repair template

    • Transform into A. pleuropneumoniae and select transformants

    • Screen for successful gene disruption

Validation of Knockout Mutants:

  • Genetic validation:

    • PCR verification using primers flanking the deletion region

    • Whole-genome sequencing to confirm deletion and absence of off-target effects

    • RT-PCR and RNA-seq to confirm lack of htpX transcript

  • Protein validation:

    • Western blot analysis using anti-HtpX antibodies

    • Proteomics analysis to confirm absence of HtpX protein

  • Functional validation:

    • Growth curve analysis under normal and stress conditions (42°C heat stress)

    • Membrane protein profile analysis

    • Complementation studies by reintroducing the functional htpX gene to restore wild-type phenotype

Phenotypic Characterization:

  • Stress response assessment:

    • Compare growth of wild-type and ΔhtpX strains under various stress conditions:

      • Heat shock (37°C vs 42°C)

      • Oxidative stress (H₂O₂ exposure)

      • Membrane-perturbing agents

  • Virulence assessment:

    • Cell adhesion and invasion assays

    • Biofilm formation capacity

    • Animal infection models to assess colonization and virulence

This systematic approach ensures the generation of reliable knockout models for studying HtpX function, while the comprehensive validation strategy confirms the specificity of observed phenotypes to HtpX deficiency rather than secondary genetic effects.

How does HtpX interact with other stress response systems in A. pleuropneumoniae under heat shock conditions?

Understanding the interplay between HtpX and other stress response systems in A. pleuropneumoniae requires integration of multiple experimental approaches. Current research suggests complex regulatory networks:

Integration with CpxAR Two-Component System:
The CpxAR system plays a crucial role in A. pleuropneumoniae resistance to heat stress . While direct regulatory connections between CpxAR and HtpX in A. pleuropneumoniae have not been fully established, evidence from related bacteria suggests potential interactions:

  • In E. coli, CpxAR regulates multiple heat shock proteins, including potential regulation of HtpX

  • RNA-seq analyses of ΔcpxAR mutants grown at 42°C revealed 265 differentially expressed genes involved in stress response

  • HtpX may function downstream of CpxAR activation during membrane protein misfolding under heat stress

Experimental Approaches to Study Interactions:

  • Transcriptional profiling:

    • Compare expression patterns of htpX in wild-type and ΔcpxAR strains under normal and heat stress conditions

    • Perform ChIP-seq to identify if CpxR directly binds to the htpX promoter region

  • Epistasis analysis:

    • Generate ΔhtpX, ΔcpxAR, and ΔhtpX/ΔcpxAR double mutants

    • Compare phenotypes under heat stress to establish genetic relationships

    • Complementation studies with controlled expression of each gene

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to detect physical interactions between HtpX and components of other stress response systems

    • Bacterial two-hybrid assays to map interaction networks

Integration with Other Stress Response Systems:

Stress Response SystemPotential Interaction with HtpXExperimental Evidence
CpxAR two-component systemPossible transcriptional regulationDifferential gene expression in ΔcpxAR mutants under heat stress
σE (RpoE) pathwayMay co-regulate with HtpX during envelope stressStudies in related bacteria show coordinated activity
Heat shock response (σH)Likely coordinates with HtpX during thermal stressHtpX classification as heat shock protein suggests σH regulation
Type IV pilus systemPossible functional interaction in stress responseCpxAR regulates type IV pilin expression under heat stress

This integrated approach reveals the complex network through which HtpX contributes to bacterial adaptation to heat stress, potentially working in concert with established systems like CpxAR to maintain membrane protein homeostasis during thermal challenges.

What is the potential role of HtpX in A. pleuropneumoniae virulence and pathogenesis?

While direct evidence for HtpX's role in A. pleuropneumoniae virulence remains limited, several lines of investigation suggest its potential contributions to pathogenesis:

Theoretical Framework for HtpX in Virulence:

  • Stress response during infection:

    • Host fever response (42°C) represents a significant stress for invading pathogens

    • HtpX, as a heat shock protein, likely contributes to bacterial adaptation to elevated temperatures encountered during infection

    • The ability to maintain protein homeostasis under stress is critical for sustained virulence

  • Membrane protein quality control:

    • As a membrane-integrated protease, HtpX likely participates in membrane protein turnover

    • Proper membrane composition is essential for:

      • Host cell adhesion and invasion

      • Resistance to host immune defenses

      • Secretion of virulence factors

  • Potential interactions with established virulence factors:

    • A. pleuropneumoniae pathogenesis involves numerous surface proteins and virulence factors

    • HtpX may regulate the abundance or activity of these factors through proteolytic processing

Research Approaches to Investigate HtpX in Pathogenesis:

  • Comparative virulence studies:

    • Compare wild-type and ΔhtpX mutant strains in:

      • Adhesion to respiratory epithelial cells

      • Resistance to serum killing

      • Survival within macrophages

      • Animal infection models focusing on lung colonization and lesion development

  • Proteomic analysis:

    • Identify changes in membrane protein composition between wild-type and ΔhtpX strains

    • Focus on known virulence factors such as Apx toxins, adhesins, and iron acquisition systems

    • Use quantitative proteomics to measure abundance changes

  • Transcriptomic studies:

    • Analyze global gene expression changes in ΔhtpX mutants under infection-mimicking conditions

    • Identify regulatory networks connecting HtpX to virulence gene expression

Integration with Known Virulence Mechanisms:
A. pleuropneumoniae pathogenesis involves multiple virulence factors including Apx toxins, adhesins, and iron acquisition systems . While HtpX has not been directly linked to these systems, it may influence their expression or function through its role in protein quality control during stress conditions encountered in the host.

This multi-faceted approach would establish whether HtpX contributes directly to A. pleuropneumoniae virulence or primarily supports bacterial survival during infection through its role in stress adaptation.

How can researchers design effective inhibitors against HtpX for potential therapeutic applications?

Designing effective inhibitors against A. pleuropneumoniae HtpX requires a structured drug discovery approach that addresses the unique challenges of targeting a membrane-embedded metalloprotease:

Target Validation and Characterization:

  • Essential function verification:

    • Confirm whether htpX is essential for A. pleuropneumoniae survival or virulence

    • Determine if chemical inhibition phenocopies genetic deletion

    • Establish relevant in vitro and in vivo assays for inhibitor screening

  • Structural characterization:

    • Determine three-dimensional structure through X-ray crystallography, cryo-EM, or homology modeling

    • Identify active site architecture and substrate binding pocket

    • Map critical catalytic residues, including the zinc-binding HEXXH motif

Inhibitor Design Strategies:

  • Structure-based design approach:

    • In silico molecular docking to identify promising lead compounds

    • Focus on compounds that:

      • Coordinate with the catalytic zinc ion

      • Interact with key residues in the substrate binding pocket

      • Demonstrate appropriate lipophilicity for membrane penetration

  • Mechanism-based inhibitors:

    • Design peptidomimetics that resemble HtpX substrates but contain zinc-chelating groups

    • Incorporate reactive groups that form covalent bonds with catalytic residues

    • Consider transition-state analog inhibitors

  • Fragment-based drug discovery:

    • Screen fragment libraries for weak binders to various sites on HtpX

    • Link or grow fragments to develop higher-affinity compounds

    • Optimize for both potency and membrane permeability

Screening and Optimization Workflow:

StageMethodologyCritical Parameters
Primary screeningHigh-throughput fluorescence-based protease assaysZ-factor >0.5; appropriate positive controls
Secondary validationOrthogonal protease assays with natural substratesConfirmation of target engagement
Selectivity profilingTesting against related metalloproteases>10-fold selectivity for HtpX
Cellular activityBacterial growth inhibition under stress conditionsActivity at <10 μM; low cytotoxicity
ADME optimizationMedicinal chemistry modificationsBalanced lipophilicity; stability in biological fluids
In vivo efficacyAnimal infection modelsEffective dose; favorable PK/PD parameters

Challenges and Considerations:

  • Membrane protein targeting:

    • Design compounds with appropriate physicochemical properties to access the membrane-embedded active site

    • Consider prodrug approaches to enhance membrane permeability

  • Selectivity:

    • Ensure selectivity against host metalloproteases to minimize toxicity

    • Design inhibitors that exploit unique features of bacterial HtpX

  • Resistance development:

    • Assess potential for resistance development through serial passage experiments

    • Consider dual-targeting approaches to reduce resistance potential

This comprehensive drug discovery strategy provides a roadmap for developing HtpX inhibitors with potential therapeutic applications against A. pleuropneumoniae infections.

How does A. pleuropneumoniae HtpX compare structurally and functionally with HtpX homologs in other bacterial pathogens?

Comparative analysis of HtpX across bacterial species reveals important evolutionary relationships and functional conservation:

Structural Comparison of HtpX Homologs:

Functional Conservation and Divergence:

The HtpX protease represents a highly conserved stress response mechanism across diverse bacterial species. In E. coli, HtpX functions alongside FtsH in the quality control of membrane proteins, particularly under stress conditions. It recognizes and degrades misfolded membrane proteins that accumulate during heat shock or other stresses.

Comparative functional analysis suggests:

  • Core functional conservation:

    • All bacterial HtpX homologs appear to participate in membrane protein quality control

    • The zinc-dependent proteolytic mechanism is preserved across species

    • Heat stress response function is broadly conserved

  • Species-specific adaptations:

    • Substrate specificity may vary between species, reflecting different membrane protein compositions

    • Regulatory networks controlling HtpX expression show species-specific architecture

    • Integration with other stress response systems varies across bacterial lineages

Evolutionary Significance:

Phylogenetic analysis places A. pleuropneumoniae HtpX within the Pasteurellaceae family cluster, showing closest homology to other members of this family. The high conservation of this protease across diverse bacterial species suggests its fundamental importance in bacterial physiology and stress adaptation.

This comparative analysis provides important context for interpreting experimental results with A. pleuropneumoniae HtpX and suggests potential functional insights based on better-characterized homologs in model organisms like E. coli.

What are the key knowledge gaps in understanding HtpX function in A. pleuropneumoniae?

Despite advances in characterizing A. pleuropneumoniae HtpX, several critical knowledge gaps remain that warrant focused research attention:

Structural Knowledge Gaps:

  • Three-dimensional structure:

    • No experimental structure exists for A. pleuropneumoniae HtpX

    • High-resolution structural data would reveal:

      • Precise coordination of the catalytic zinc

      • Substrate binding pocket architecture

      • Membrane-embedded topology

    • Methodological challenges include protein crystallization of membrane proteins

  • Conformational dynamics:

    • Unknown how HtpX structure changes during substrate recognition and catalysis

    • Unclear how transmembrane domains participate in substrate recruitment

Functional Knowledge Gaps:

  • Substrate identification:

    • Specific physiological substrates remain unidentified

    • Unknown substrate recognition motifs or sequences

    • Proteomic approaches needed to identify the HtpX "degradome"

  • Regulatory mechanisms:

    • Incomplete understanding of htpX transcriptional regulation

    • Unknown post-translational modifications affecting HtpX activity

    • Potential integration with CpxAR and other stress response systems remains speculative

  • Physiological role:

    • Quantitative contribution to heat stress survival unclear

    • Unknown whether HtpX processes specific virulence factors

    • Role in bacterial fitness during infection remains unexplored

Methodological Challenges:

  • In vitro assay limitations:

    • Current assays may not fully recapitulate the membrane environment

    • Difficulties in distinguishing direct vs. indirect effects in complex systems

  • Genetic tool limitations:

    • Challenges in generating conditional mutants in A. pleuropneumoniae

    • Limited molecular genetic tools compared to model organisms

Translational Knowledge Gaps:

  • Therapeutic targeting:

    • Unknown druggability of the HtpX active site

    • Unclear whether HtpX inhibition would attenuate virulence

    • Need for species-specific inhibitors to avoid targeting host metalloproteases

Addressing these knowledge gaps requires innovative approaches combining structural biology, proteomics, genetics, and biochemistry to fully elucidate the role of HtpX in A. pleuropneumoniae biology and pathogenesis.

What emerging technologies could advance research on A. pleuropneumoniae HtpX?

Several cutting-edge technologies offer promising approaches to overcome current research limitations and advance understanding of HtpX function:

Advanced Structural Biology Approaches:

  • Cryo-electron microscopy (Cryo-EM):

    • Circumvents crystallization challenges for membrane proteins

    • Can capture multiple conformational states of HtpX during catalytic cycle

    • Recent advances enable near-atomic resolution of membrane proteins in native lipid environments

    • Methodology: Purify HtpX in nanodiscs or amphipols for single-particle cryo-EM analysis

  • Integrative structural modeling:

    • Combines multiple data sources (cryo-EM, crosslinking, molecular dynamics)

    • Predicts protein-substrate interactions in membrane environment

    • Methodology: Cross-reference experimental constraints with computational models

Next-Generation Functional Genomics:

  • CRISPR interference (CRISPRi) and CRISPR activation (CRISPRa):

    • Enables tunable gene expression without complete knockout

    • Allows temporal control of htpX expression during infection

    • Methodology: Develop dCas9-based systems optimized for A. pleuropneumoniae

  • Transposon sequencing (Tn-seq):

    • Identifies genetic interactions with htpX

    • Reveals conditional essentiality under stress conditions

    • Methodology: Generate transposon libraries in wild-type and ΔhtpX backgrounds

Advanced Proteomics Approaches:

  • Proximity-dependent labeling:

    • Identifies proteins in close proximity to HtpX in living cells

    • Reveals potential substrates and interacting partners

    • Methodology: Express HtpX fused to BioID or APEX2 for in vivo biotinylation

  • Targeted proteomics with selective reaction monitoring (SRM):

    • Quantifies specific protein degradation events with high sensitivity

    • Monitors substrate processing in real-time

    • Methodology: Develop SRM assays for candidate HtpX substrates

Innovative Biochemical Methods:

  • Nanodiscs and proteoliposomes:

    • Reconstitutes HtpX in native-like membrane environment

    • Enables controlled biochemical assays with defined components

    • Methodology: Optimize nanodisc composition for HtpX stability and activity

  • Activity-based protein profiling (ABPP):

    • Uses activity-dependent chemical probes to monitor HtpX activity

    • Distinguishes active from inactive forms of the protease

    • Methodology: Design zinc-binding probes that selectively target active HtpX

High-Resolution Imaging Technologies:

  • Super-resolution microscopy:

    • Visualizes HtpX localization within bacterial cells at nanometer resolution

    • Reveals dynamic redistribution during stress response

    • Methodology: Express fluorescently-tagged HtpX and image using techniques like PALM or STORM

These emerging technologies, particularly when used in complementary combinations, offer unprecedented opportunities to address the key knowledge gaps in A. pleuropneumoniae HtpX research, potentially leading to novel therapeutic strategies targeting this important stress response protein.

What is the significance of studying HtpX for broader understanding of bacterial stress responses?

Research on Actinobacillus pleuropneumoniae HtpX contributes significantly to our understanding of bacterial stress adaptation mechanisms with broad implications for microbiology and infectious disease research:

Fundamental Insights into Bacterial Physiology:

HtpX represents a conserved stress response system in gram-negative bacteria that maintains membrane protein homeostasis during environmental challenges. Understanding its function in A. pleuropneumoniae provides insights into fundamental bacterial physiology, particularly how pathogens maintain cellular integrity during host-imposed stresses like fever.

The integration of HtpX into broader stress response networks, potentially including the CpxAR two-component system , illustrates the complex regulatory architecture that bacteria employ to sense and respond to environmental perturbations. This knowledge enhances our understanding of bacterial adaptation mechanisms beyond a single pathogen species.

Translational Significance for Infectious Disease:

Bacterial stress response systems represent potential targets for novel antimicrobial development. As conventional antibiotics face increasing resistance challenges, targeting stress adaptation mechanisms like HtpX could provide alternative therapeutic approaches that attenuate bacterial survival under host-imposed stress conditions rather than directly killing bacteria.

The high conservation of HtpX across diverse bacterial species suggests that insights gained from A. pleuropneumoniae could inform strategies relevant to multiple pathogens, potentially leading to broad-spectrum approaches targeting bacterial stress adaptation.

Methodological Advances:

Research on membrane-integrated proteases like HtpX drives technological innovation in protein biochemistry, structural biology, and functional genomics. Overcoming the challenges of studying membrane proteins contributes methodological advances applicable across biological research.

Future Directions and Integration:

Future research integrating structural insights, physiological functions, and potential roles in pathogenesis will position HtpX within the broader context of bacterial stress biology. As research progresses from basic characterization to functional understanding, HtpX may emerge as a model system for studying membrane protein quality control in bacterial pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.