Recombinant Actinobacillus succinogenes ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; Asuc_0332; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-261
Protein Length
full length protein
Species
Actinobacillus succinogenes (strain ATCC 55618 / 130Z)
Target Names
atpB
Target Protein Sequence
MAGTTAGYIGHHLTFLSSGEGFWAVHLDTLFFSIVSALIFLFVFRNVAKKATSGVPGKLQ CMVEIVVEWINGIVKENFHGPRNVVAPLALTIFCWVFIMNAIDLIPVDFLPQLAGLFGIH YLRAVPTADISATLGMSLCVFALILFYTVKSKGFGGLVKEYTLHPFNHWTLVPVNFILET VTLLAKPISLAFRLFGNMYAGELIFILIAVMYSANAAIAALGIPLHLAWAIFHILIITLQ AFIFMMLTVVYLSIAYNKAEH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a key component of the proton channel and plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit a (atpB) in Actinobacillus succinogenes?

ATP synthase subunit a (atpB) is an integral membrane protein component of the F0 sector in the F1F0-ATP synthase complex in A. succinogenes. This enzyme consists of multiple subunits arranged in the structure α3:β3:γ:δ:ε:a:b2:c10, with atpB (subunit a) playing a crucial role in proton translocation across the cellular membrane. The full-length protein consists of 261 amino acids and is encoded by the atpB gene (also known as Asuc_0332) . As part of the complete ATP synthase complex, atpB contributes to the organism's energy metabolism, which is particularly important for A. succinogenes as a strictly respiratory organism that produces succinic acid as a primary metabolite .

How does recombinant atpB differ from native atpB in experimental applications?

Recombinant and native atpB exhibit several key differences that impact experimental applications:

FeatureNative atpBRecombinant atpB
Expression hostA. succinogenesTypically E. coli
Protein contextIntegrated within complete ATP synthase complexOften expressed as isolated subunit
Post-translational modificationsContains modifications specific to A. succinogenesMay lack native modifications
Fusion tagsNoneCommonly includes N-terminal His-tag
SolubilityMembrane-integratedRequires detergents for solubilization
Functional assemblyPart of complete functional complexMay require reconstitution for activity studies
Purification methodComplex membrane protein isolationAffinity chromatography using fusion tags

These differences are significant for researchers designing experiments. Native atpB functions within the complete ATP synthase complex in its natural lipid environment, while recombinant atpB requires careful reconstitution approaches to study its authentic function . Researchers must consider these differences when interpreting results from in vitro studies using recombinant protein versus in vivo studies examining native protein function.

What expression systems and purification methods yield the highest purity recombinant atpB?

The expression and purification of high-quality recombinant A. succinogenes atpB requires specialized approaches:

Expression SystemAdvantagesDisadvantagesTypical Yield
E. coli BL21(DE3)High expression levels, well-established protocolsPotential inclusion body formation1-5 mg/L culture
E. coli C41/C43(DE3)Specialized for membrane proteins, reduces toxicityLower expression levels0.5-2 mg/L culture
Cell-free systemsAvoids toxicity issues, direct condition controlHigher cost, lower yield<1 mg/reaction

For optimal expression in E. coli, recommended conditions include:

  • Induction at lower temperature (16-20°C)

  • Reduced IPTG concentration (0.1-0.5 mM)

  • Extended expression time (16-24 hours)

  • Addition of membrane-stabilizing compounds

A multi-step purification protocol typically yields >90% purity :

  • Cell lysis in buffer containing appropriate detergents (e.g., DDM, LDAO)

  • IMAC purification utilizing the His-tag

  • Ion exchange chromatography as a secondary purification step

  • Size exclusion chromatography for final polishing

For storage, the purified protein should be maintained in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . Long-term storage requires addition of 50% glycerol and storage at -80°C, with aliquoting to avoid freeze-thaw cycles .

How does atpB contribute to energy metabolism and succinic acid production in A. succinogenes?

AtpB plays a critical role in A. succinogenes energy metabolism that indirectly impacts succinic acid production:

Metabolic FunctionMechanismRelationship to Succinic Acid Production
ATP synthesisFacilitates proton translocation driving ATP formationProvides energy for biosynthetic reactions
Proton motive force maintenanceContributes to membrane potentialInfluences transport processes for substrates and products
Metabolic flux regulationAffects energy availability for various pathwaysShifts carbon flux distribution between growth and product formation
NADH/NAD+ ratio managementIndirectly affects redox cofactor availabilityImpacts reductive pathways leading to succinic acid

A. succinogenes has unique metabolic characteristics that make ATP synthase particularly important:

  • It possesses an incomplete TCA cycle that natively terminates at succinic acid

  • The organism is capnophilic, incorporating CO2 into succinic acid, requiring energy

  • ATP generation influences the balance between biomass formation and product synthesis

Genome-scale metabolic modeling of A. succinogenes (model iBP722) has demonstrated that ATP synthase activity significantly affects calculated flux distributions under different fermentation conditions . Specifically, the model shows that carbon dioxide fixation pathways and ATP synthesis are interconnected, with the transport mechanism of carbon sources and ability to fix CO2 being crucial determinants of metabolic flux .

How stable is recombinant atpB under various storage and experimental conditions?

The stability of recombinant A. succinogenes atpB varies significantly under different conditions:

ConditionStability DurationRecommended Storage MethodActivity Retention
Lyophilized powder1-2 years-20°C to -80°C>90%
Solution with glycerol6-12 months-80°C (50% glycerol)70-90%
Solution without cryoprotectant1-3 months-80°C40-60%
Working solutionUp to 1 week4°C70-80%
Room temperature<24 hoursN/ARapid decline

For optimal stability, commercial preparations recommend:

  • Avoiding repeated freeze-thaw cycles

  • Using Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Adding 5-50% glycerol for long-term storage (with 50% being optimal)

  • Reconstituting lyophilized protein to 0.1-1.0 mg/mL concentration

During experimental procedures, stability can be enhanced by:

  • Maintaining consistent temperature (4°C during handling)

  • Including appropriate detergents to maintain membrane protein solubility

  • Adding reducing agents to prevent oxidation of cysteine residues

  • Minimizing exposure to proteases and other degradative enzymes

These stability parameters are crucial for researchers planning long-term studies or designing experimental protocols that require consistent protein quality across multiple experimental sessions.

How can site-directed mutagenesis of atpB affect ATP synthesis/hydrolysis in experimental systems?

Site-directed mutagenesis of A. succinogenes atpB provides valuable insights into structure-function relationships of ATP synthase. Drawing from related studies on ATP synthase in A. baumannii , several key mutation targets can be identified:

Target RegionSpecific ResiduesPredicted EffectExperimental Readout
Proton channelConserved charged/polar residuesAltered proton translocation efficiencyProton pumping assays, ATP synthesis rate
Subunit interfacesResidues interacting with c-ringDisrupted rotary mechanismATP hydrolysis activity, complex stability
C-terminal domainRegulatory elementsChanged inhibition patternsATP hydrolysis rates with/without regulators
Transmembrane helicesConserved glycines, prolinesAltered helical packingMembrane integration efficiency

Research on A. baumannii ATP synthase demonstrates that modifications to regulatory elements can dramatically impact function. For example, removal of the inhibitory ε subunit resulted in a 21.5-fold increase in ATP hydrolysis activity . Similar principles likely apply to A. succinogenes ATP synthase.

Experimental approaches should include:

  • Creating mutations using overlap extension PCR or commercial site-directed mutagenesis kits

  • Expressing mutant proteins in appropriate hosts

  • Purifying and reconstituting mutants into liposomes or nanodiscs

  • Measuring ATP synthesis/hydrolysis activities under standardized conditions

  • Structural characterization using techniques like hydrogen-deuterium exchange mass spectrometry

These studies would reveal how specific residues in atpB contribute to the unique properties of A. succinogenes ATP synthase, potentially identifying targets for metabolic engineering to enhance succinic acid production.

What metabolic engineering strategies involving atpB could enhance succinic acid production?

ATP synthase engineering represents a promising but underexplored approach for enhancing succinic acid production in A. succinogenes. Several strategies can be proposed based on our understanding of ATP synthase function and A. succinogenes metabolism:

Engineering StrategyMechanismPotential ImpactTechnical Approach
Modulation of atpB expressionOptimize ATP synthesis capacityBalanced energy metabolism for productionPromoter engineering, RBS modifications
ATP synthase complex modificationAlter regulatory propertiesControlled ATP hydrolysis during productionSite-directed mutagenesis of key subunits
P/O ratio engineeringOptimize ATP yield per NADH oxidizedMore efficient energy conservationTargeted mutations in proton channel residues
Integration with CO2 fixationCoordinate energy supply with CO2 incorporationEnhanced carbon efficiencyCo-regulation of ATP synthase with carboxylation enzymes
Coupling with redox engineeringBalance ATP and redox cofactor availabilityOptimized metabolic flux distributionCombinatorial engineering approach

These strategies should be evaluated in the context of A. succinogenes' unique metabolism:

  • The organism has an incomplete TCA cycle terminating at succinic acid

  • It incorporates CO2 into succinic acid, requiring energy

  • ATP availability affects the balance between growth and product formation

Implementation would utilize genetic tools developed for A. succinogenes, including:

  • Homologous recombination with linear PCR fragments containing genomic homology regions

  • The pLGZ920 expression vector system encoding chloramphenicol resistance

  • Cre-lox systems for marker recycling in sequential genetic modifications

Genome-scale metabolic modeling (using model iBP722) would be valuable for predicting the effects of these manipulations before experimental implementation . The model contains 1072 enzymatic reactions associated with 722 metabolic genes and can simulate various growth and production conditions .

How does atpB structure in A. succinogenes compare to homologs in other bacterial species?

Comparative analysis of atpB across bacterial species reveals important evolutionary and functional insights:

SpeciesatpB FeaturesKey Structural ElementsFunctional Implications
A. succinogenes261 aa, highly hydrophobic Multiple transmembrane helicesAdapted for efficient energy conservation during succinic acid production
A. baumanniiExtended C-terminal domain configurationRegulatory interactions with other subunitsSelf-inhibition mechanism prevents wasteful ATP hydrolysis
E. coliWell-characterized proton channelConserved charged residues in transmembrane helicesEstablished model for proton translocation mechanism
MycobacteriaAdaptations for functioning at lower PMFModified interfaces between subunitsOperation under challenging energetic conditions
Thermophilic bacteriaEnhanced stability featuresAdditional ion pairs, hydrophobic interactionsFunctional at elevated temperatures

Studies on A. baumannii ATP synthase provide valuable comparative insights:

  • The architecture and regulatory elements visualized by cryo-EM at 3.0 Å resolution revealed the C-terminal domain of subunit ε in an extended position

  • Removal of regulatory elements resulted in dramatically increased ATP hydrolysis

  • Mutational studies identified critical residues for domain-domain interactions

For A. succinogenes specifically, its atpB likely contains adaptations related to:

  • Its capnophilic nature and CO2 incorporation capabilities

  • Role in succinic acid production as a primary fermentation product

  • Ability to utilize various carbon sources including pentose and hexose sugars

Detailed structural comparison would require techniques such as:

  • Homology modeling based on resolved ATP synthase structures

  • Evolutionary analysis to identify conserved functional residues

  • Molecular dynamics simulations to predict structure-function relationships

How can genome-scale metabolic models predict the effects of atpB modifications?

Genome-scale metabolic models (GSMMs) provide powerful platforms for predicting the effects of atpB modifications in A. succinogenes. The existing GSMM for A. succinogenes, iBP722 , offers a robust foundation for such analyses:

Modeling ApproachImplementation MethodPredictive CapabilityKey Parameters
Flux Balance Analysis (FBA)Modify ATP synthase stoichiometry or constraintsPredicts optimal flux distributionsGrowth rate, succinic acid yield
Flux Variability Analysis (FVA)Set ATP synthesis/hydrolysis flux boundariesIdentifies range of possible metabolic statesMin/max flux ranges through key reactions
Robustness AnalysisSystematically vary ATP synthase activityMaps relationship between ATP flux and product formationSensitivity of succinic acid production to ATP availability
Knockout SimulationsIn silico atpB modificationsPredicts viability and phenotypic effectsGrowth capability, alternative pathway activation
Pareto Optimality AnalysisMulti-objective optimizationBalances competing metabolic objectivesTrade-offs between growth and product formation

The iBP722 model features:

  • Coverage of 1072 enzymatic reactions associated with 722 metabolic genes

  • 713 metabolites involved in A. succinogenes metabolism

  • Validated ability to predict growth on various carbon sources and succinic acid production

To model atpB modifications specifically:

  • Identify reactions involving ATP synthase in the model

  • Modify constraints to reflect expected changes in ATP synthesis efficiency

  • Incorporate experimental data on ATP synthase kinetics when available

  • Simulate under various media conditions and environmental parameters

  • Analyze predicted flux distributions through central carbon metabolism

  • Identify potential bottlenecks or unexpected consequences

The metabolic model has demonstrated that CO2 fixation pathways and ATP synthesis are interconnected, with carbon source transport mechanisms being crucial determinants of metabolic flux . This suggests that atpB modifications could have complex ripple effects throughout metabolism that can be effectively predicted using GSMM approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.