Recombinant Actinobacillus succinogenes ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant atpF subunit is synthesized via heterologous expression in E. coli, leveraging the bacterium’s high-yield protein production capabilities. Key steps include:

  • Cloning: The atpF gene (1-156 aa) is inserted into a plasmid under a strong promoter .

  • Induction: Expression is induced using IPTG, followed by lysis and centrifugation .

  • Purification: Affinity chromatography via the His tag ensures high purity .

Challenges:

  • The protein’s transmembrane nature complicates solubility, requiring detergents or lipid mimetics during extraction .

Role in A. succinogenes Metabolism

ATP synthase in A. succinogenes is central to energy metabolism during succinic acid (SA) biosynthesis. Key findings from related studies:

  • SA Production: A. succinogenes achieves SA yields up to 100 g/L under optimized conditions, reliant on efficient ATP regeneration .

  • Metabolic Engineering: Knockout of competing pathways (e.g., ackA for acetate) enhances SA purity but reduces ATP supply, highlighting the need for balanced ATP synthase activity .

  • Energetic Coupling: Proton gradient generation by atpF-containing ATP synthase is critical for SA export via transporters like Asuc_0715/0716 .

Table 2: Key Studies Involving atpF or Related Pathways

Study FocusFindingsSource
SA BiosynthesisOverexpression of malate dehydrogenase (MDH) increases SA flux
Byproduct ReductionΔpflB mutants show reduced formate but require compensatory ATP synthesis
Transporter FunctionAsuc_0914 identified as glucose importer; SA export requires ATP synergy

Future Directions

  • Structural Studies: Cryo-EM analysis of recombinant atpF could reveal proton translocation mechanisms.

  • Strain Optimization: Coupling atpF overexpression with SA transporter engineering may boost production efficiency .

  • Industrial Relevance: Integration into biorefineries for CO₂-to-SA conversion aligns with sustainability goals .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific requests for the format. Please indicate your preference in the order notes, and we will fulfill your requirement to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery information.
Note: Our default shipping method includes standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we suggest centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpF; Asuc_0330; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Actinobacillus succinogenes (strain ATCC 55618 / 130Z)
Target Names
atpF
Target Protein Sequence
MNLNATLIGQLIAFALFTWFCVKFVWPPIIKAIEERQSSIANALASAEAARKEQADTKTLAEEEITKAKIQAQEIIDSANKRRNEVLDEVKAEAETLKAKIIEQGYAEVEAERKRVQEELRVKVASLAIAGAEKIVGRTVDEAANNDIIDKLVAEL
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase catalyzes the production of ATP from ADP in the presence of a proton or sodium gradient. It comprises two structural domains: F(1), which contains the extramembraneous catalytic core, and F(0), which houses the membrane proton channel. These domains are connected by a central stalk and a peripheral stalk. During catalysis, ATP synthesis within the catalytic domain of F(1) is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel and forms part of the peripheral stalk, linking F(1) to F(0).
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is ATP synthase subunit b (atpF) in Actinobacillus succinogenes?

ATP synthase subunit b (atpF) in A. succinogenes is a critical component of the F₀ sector of the ATP synthase complex, which is responsible for ATP generation through oxidative phosphorylation. The atpF gene encodes a membrane-bound protein that forms part of the stator stalk connecting the F₁ and F₀ domains of ATP synthase. In A. succinogenes, this protein plays a particularly important role due to the organism's unique metabolic capabilities as a facultative anaerobe that can convert various sugars to succinic acid with high yield . The protein contains hydrophobic domains that anchor it to the membrane and hydrophilic regions that interact with other subunits of the ATP synthase complex. Understanding atpF structure and function is essential for comprehending A. succinogenes energy metabolism, especially considering its capnophilic nature and ability to incorporate CO₂ into succinic acid.

How does atpF contribute to the unique metabolic capabilities of A. succinogenes?

The atpF subunit contributes significantly to A. succinogenes' metabolic versatility by helping maintain proper ATP synthase function during shifts between aerobic and anaerobic metabolism. A. succinogenes can convert both pentose and hexose sugars to succinic acid (SA) with high yield through the tricarboxylic acid (TCA) cycle, with atpF playing a crucial role in energy conservation during these conversions . The ATP synthase complex, of which atpF is an integral component, generates ATP needed for cellular processes including the energetically demanding steps in the reductive branch of the TCA cycle leading to SA production. Because A. succinogenes is capnophilic, incorporating CO₂ into SA, the energy dynamics facilitated by properly functioning ATP synthase are essential for maintaining redox balance during carbon fixation. When researchers engineer A. succinogenes for enhanced SA production through manipulations like knockout of competing pathways (acetate and formate production), the resulting strain's energy metabolism—supported by atpF function—becomes crucial for maintaining cellular viability while redirecting carbon flux.

What techniques are available to analyze atpF gene expression in A. succinogenes?

Several complementary techniques can be employed to analyze atpF gene expression in A. succinogenes. Quantitative PCR (qPCR) remains the gold standard for measuring transcript levels, requiring careful primer design targeting conserved regions of the atpF gene. RNA-seq provides a more comprehensive view of expression in the context of the entire transcriptome, allowing researchers to correlate atpF expression with other genes in the ATP synthase operon or related metabolic pathways. For protein-level analysis, western blotting using antibodies specific to atpF or mass spectrometry-based proteomics can quantify protein abundance. Additionally, reporter gene fusions (e.g., lacZ or fluorescent proteins) can be created using the genetic manipulation techniques developed for A. succinogenes, as described in the literature on markerless knockout methods . When designing these experiments, researchers should consider that atpF expression may vary significantly under different growth conditions, particularly when comparing aerobic versus anaerobic cultivation, or when different carbon sources are utilized.

What expression systems are most suitable for recombinant A. succinogenes atpF production?

For recombinant production of A. succinogenes atpF, E. coli expression systems are most commonly employed due to their versatility and well-established protocols. Based on successful expression of similar membrane proteins, BL21(DE3) or C41/C43(DE3) strains are particularly suitable for atpF expression due to their tolerance for potentially toxic membrane proteins . Vector selection depends on research objectives: pET vectors with T7 promoters offer high expression levels but may require tight regulation, while arabinose-inducible pBAD vectors provide more controlled expression that may improve proper folding. For membrane proteins like atpF, vectors that produce fusion constructs with solubility tags (such as MBP, SUMO, or TrxA) often improve yield and solubility. When designing the construct, researchers should consider adding a polyhistidine tag (His-tag) at either the N- or C-terminus to facilitate purification, similar to the approach used for Bacillus pumilus atpF . For applications requiring native protein characteristics, cleavage sites between the tag and atpF sequence should be incorporated.

What are the optimal conditions for expressing and purifying recombinant A. succinogenes atpF?

Optimal expression of recombinant A. succinogenes atpF in E. coli typically requires careful consideration of induction conditions and membrane protein handling. Expression should be conducted at lower temperatures (16-25°C) following induction to slow protein synthesis and improve folding outcomes. IPTG concentrations should be kept low (0.1-0.5 mM) for T7-based systems, with extended expression times (16-24 hours) to maximize yield while minimizing inclusion body formation. The growth medium composition significantly impacts expression success, with terrific broth (TB) or 2xYT often outperforming standard LB, particularly when supplemented with glucose to prevent leaky expression. For purification, a multi-step process is recommended, beginning with membrane fraction isolation through differential centrifugation followed by solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) . Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin effectively captures His-tagged atpF, followed by size exclusion chromatography to achieve high purity. Throughout purification, maintaining detergent concentrations above critical micelle concentration prevents protein aggregation while preserving native-like conformation.

What challenges are specific to A. succinogenes atpF expression and how can they be addressed?

Recombinant expression of A. succinogenes atpF presents several specific challenges owing to its nature as a membrane protein and its role in the multi-subunit ATP synthase complex. The primary challenge is potential toxicity when overexpressed, as accumulation of membrane proteins can disrupt host cell membrane integrity. This can be addressed by using specialized E. coli strains like C41/C43(DE3) that are designed to tolerate membrane protein overexpression, or by employing tightly regulated expression systems with careful induction timing. Another significant challenge is ensuring proper membrane insertion and folding, which can be improved by co-expressing molecular chaperones like GroEL/GroES or by using cold-shock expression protocols. Protein aggregation during purification represents another major hurdle, requiring optimization of detergent types and concentrations during each purification step. For functional studies, maintaining protein stability post-purification often necessitates reconstitution into proteoliposomes or nanodiscs to provide a membrane-like environment. When aiming to study protein-protein interactions within the ATP synthase complex, co-expression with other A. succinogenes ATP synthase subunits may be necessary to obtain physiologically relevant structural arrangements.

What experimental approaches can determine the structure of A. succinogenes atpF?

Multiple complementary experimental approaches can be employed to elucidate the structure of A. succinogenes atpF at different resolution levels. X-ray crystallography remains the gold standard for high-resolution structural determination, though crystallizing membrane proteins like atpF presents significant challenges requiring extensive condition screening and often the use of lipidic cubic phase crystallization methods. Cryo-electron microscopy (cryo-EM) has emerged as a powerful alternative, particularly suitable for membrane proteins and multi-protein complexes like ATP synthase, potentially allowing visualization of atpF in its native context within the F₀ sector. For lower-resolution structural insights, circular dichroism spectroscopy can provide valuable information about secondary structure content and protein folding stability. Nuclear magnetic resonance (NMR) spectroscopy, while challenging for full-length membrane proteins, can be applied to soluble domains or fragments of atpF to determine local structural elements. Computational approaches, including homology modeling based on known structures from related organisms like those available for Bacillus species, can provide initial structural models that guide experimental design . Cross-linking mass spectrometry offers valuable insights into spatial relationships between atpF and other ATP synthase subunits, particularly useful for understanding the protein's functional context.

How does atpF structure relate to its function in the ATP synthase complex?

The structural features of atpF directly determine its functional role in the ATP synthase complex. AtpF forms a critical component of the peripheral stalk (stator) that connects the membrane-embedded F₀ sector with the catalytic F₁ sector of ATP synthase. The N-terminal domain of atpF typically contains a transmembrane helix that anchors the protein in the membrane, while the extended C-terminal domain forms a right-handed coiled-coil structure that interacts with the δ subunit of F₁. This arrangement enables atpF to function as a structural brace that prevents the F₁ sector from rotating with the c-ring during ATP synthesis, thereby allowing the mechanical energy of proton translocation to be converted to the chemical energy of ATP. The specific amino acid composition of the coiled-coil region, which likely includes distinctive heptad repeats as seen in the related B. pumilus atpF sequence, determines the stability and rigidity of the stator assembly . Mutations in conserved residues can disrupt these interactions, potentially affecting the efficiency of energy coupling between proton translocation and ATP synthesis. Understanding these structure-function relationships is crucial for interpreting how modifications to atpF might influence the bioenergetics of A. succinogenes, particularly in engineered strains designed for enhanced succinic acid production.

What functional assays can be used to evaluate recombinant atpF activity?

Several assays can evaluate the functionality of recombinant atpF within the context of ATP synthase activity. ATP synthesis and hydrolysis assays provide direct measures of ATP synthase function when atpF is reconstituted with other subunits. For ATP synthesis measurement, proteoliposomes containing reconstituted ATP synthase components including atpF can be energized with an artificial proton gradient, followed by quantification of ATP production using luciferase-based luminescence assays. Conversely, ATP hydrolysis can be measured spectrophotometrically by coupling ADP production to NADH oxidation via pyruvate kinase and lactate dehydrogenase enzymes. Proton pumping assays using pH-sensitive fluorescent dyes (such as ACMA or pyranine) can assess the ability of the complex containing recombinant atpF to couple ATP hydrolysis to proton translocation. Binding assays, including isothermal titration calorimetry or surface plasmon resonance, can evaluate interactions between recombinant atpF and other ATP synthase subunits, particularly the δ subunit. For assessment of structural integrity, limited proteolysis followed by mass spectrometry analysis can verify proper folding by identifying protected regions that correspond to structured domains. When evaluating these functional parameters, it's essential to compare the recombinant atpF activity to that of the native complex as a benchmark for successful recombinant production.

What methods are available for creating atpF mutants in A. succinogenes?

Several genetic manipulation methods are available for creating atpF mutants in A. succinogenes. A markerless knockout method has been developed that employs natural transformation or electroporation, providing a versatile approach for gene deletion or modification . This technique utilizes a selection marker (such as the isocitrate dehydrogenase gene icd) flanked by FRT sites and homologous regions to the target gene, allowing for both positive selection of transformants and subsequent marker removal. For atpF-specific modifications, researchers can design constructs with 600-1000 bp homologous regions flanking the atpF gene to ensure efficient recombination. The study demonstrates that even shorter homologous regions (200 bp) can be sufficient for double recombination events, though with potentially lower efficiency . For point mutations or minor modifications rather than complete knockouts, overlap extension PCR can be employed to introduce specific nucleotide changes. Additionally, CRISPR-Cas9 systems adapted for A. succinogenes could provide more precise genome editing capabilities, though this would require optimization of guide RNA design and delivery methods. When designing atpF mutation strategies, researchers should consider the essential nature of ATP synthase for energy metabolism and may need to employ conditional mutation approaches if complete knockouts prove lethal.

How can one assess the phenotypic impacts of atpF modifications in A. succinogenes?

Comprehensive phenotypic assessment of atpF modifications requires a multi-faceted approach examining growth characteristics, bioenergetics, and metabolic outputs. Growth rate analysis under various carbon sources (both hexoses and pentoses) and environmental conditions (aerobic, microaerobic, and anaerobic) provides fundamental insights into how atpF modifications affect cellular fitness . Membrane potential measurements using fluorescent probes like DiSC3(5) can quantify the impact on proton gradient maintenance. ATP/ADP ratio determination using bioluminescence assays or HPLC provides direct evidence of altered energy metabolism. Metabolic flux analysis using 13C-labeled substrates can reveal how atpF modifications redistribute carbon flow through central metabolism, particularly important given A. succinogenes' capability for succinic acid production . Organic acid profiles (including succinate, acetate, formate, and lactate) should be quantified via HPLC to detect shifts in fermentation patterns, as seen when other pathways are manipulated . Respirometry measurements can assess oxygen consumption rates if atpF modifications affect aerobic metabolism. Transcriptomic and proteomic analyses provide comprehensive insights into compensatory responses across the genome. When comparing wildtype and atpF-modified strains, researchers should standardize growth conditions and sampling points to ensure meaningful comparisons, particularly given that phenotypic effects may vary significantly with growth phase and environmental conditions.

How can recombinant atpF be utilized in bioenergy research related to A. succinogenes?

Recombinant atpF from A. succinogenes offers several promising applications in bioenergy research, particularly in developing systems for efficient conversion of renewable feedstocks to valuable products. Purified recombinant atpF can serve as a component for in vitro reconstitution studies aimed at understanding and optimizing ATP generation during lignocellulosic sugar metabolism, a critical factor in biorefinery economics . Researchers can employ structure-guided protein engineering of atpF to create variants with enhanced stability or altered regulatory properties, potentially improving ATP synthesis efficiency during fermentation of challenging feedstocks like lignocellulosic hydrolysates. Recombinant atpF labeled with fluorescent tags can be used for real-time imaging studies to investigate ATP synthase assembly and localization during shifts between carbon sources or environmental conditions. The protein can also serve as an antigen for developing A. succinogenes-specific antibodies, enabling immunodetection methods for monitoring ATP synthase expression levels during bioprocess development. Additionally, comparative biochemical studies between recombinant atpF from A. succinogenes and equivalent proteins from other industrially relevant organisms could reveal unique adaptations that contribute to A. succinogenes' exceptional succinate-producing capabilities, potentially informing the design of synthetic bioenergy systems with enhanced performance.

What insights can be gained from comparing atpF across different strains and related species?

Comparative analysis of atpF across different A. succinogenes strains and related species can provide valuable evolutionary and functional insights with implications for metabolic engineering. Sequence alignment studies can identify conserved domains that are likely essential for function versus variable regions that may confer strain-specific adaptations to different ecological niches or carbon sources. Such analysis may reveal signature sequences associated with capnophilic organisms like A. succinogenes that incorporate CO₂ during metabolism . Structural modeling based on sequence variations can predict differences in protein stability or interaction interfaces with other ATP synthase components, potentially explaining variations in bioenergetic efficiency between strains. Experimental comparisons of recombinant atpF proteins from different sources through biochemical and biophysical methods can validate these computational predictions and identify properties that correlate with desirable phenotypes like enhanced succinic acid production. Phylogenetic analysis incorporating atpF sequences alongside other ATP synthase components can reveal co-evolutionary patterns and horizontal gene transfer events that shaped the evolution of bioenergetic systems in these bacteria. When conducting such comparative studies, researchers should consider including both closely related species within the Pasteurellaceae family and more distant relatives with similar metabolic capabilities to distinguish lineage-specific from function-specific adaptations.

What methodological approaches can improve recombinant atpF yield and functionality for structural studies?

Maximizing recombinant atpF yield and functionality for structural studies requires sophisticated methodological approaches tailored to membrane protein characteristics. Expression in specialized host strains like C41/C43(DE3) with codon optimization for A. succinogenes-specific usage patterns can significantly enhance translation efficiency. Incorporating fusion partners such as Mistic or SUMO can improve membrane targeting and solubility, with careful design of linker regions and protease cleavage sites for subsequent tag removal . For challenging expression cases, cell-free protein synthesis systems offer advantages by circumventing toxicity issues and allowing direct incorporation of detergents or nanodiscs during synthesis. Purification protocols should employ fluorescence-based thermostability assays to screen multiple detergent and buffer combinations, identifying conditions that maximize protein stability. For crystallography purposes, surface entropy reduction through strategic mutation of flexible, solvent-exposed residues with high conformational entropy (typically lysine and glutamate clusters) to alanine can promote crystal formation. Alternatively, antibody fragment (Fab) co-crystallization or crystallization chaperones like designed ankyrin repeat proteins (DARPins) can provide rigid scaffolds that facilitate crystal contacts. For cryo-EM studies, GraFix (gradient fixation) techniques can stabilize protein complexes containing atpF by mild crosslinking during glycerol gradient centrifugation, improving particle homogeneity and image processing outcomes. Implementation of these advanced methodologies requires careful optimization for the specific characteristics of A. succinogenes atpF but offers the potential for breakthrough structural insights.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.