Recombinant Actinobacillus succinogenes Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Description

General Structure of Fumarate Reductase Complexes

Fumarate reductase (FRD) is a membrane-bound enzyme complex that catalyzes the reduction of fumarate to succinate using two electrons. In most organisms, including Escherichia coli, which serves as a model system, the FRD complex consists of four nonidentical subunits: FRDA, FRDB, FRDC, and FRDD . These subunits are arranged in two distinct functional domains: (i) the FRDAB catalytic domain and (ii) the FRDCD membrane anchor domain . The FRDAB domain contains the active catalytic site where fumarate reduction occurs, while the FRDCD domain is embedded in the membrane and is essential for electron transfer and proton translocation reactions involving electron carriers such as menaquinone .

The amino acid sequences of the catalytic subunits (FRDA and FRDB) are highly conserved across different bacterial species, reflecting their critical role in the enzymatic reaction . In contrast, the membrane-anchor subunits (FRDC and FRDD) show greater variability, potentially reflecting adaptations to different cellular environments and electron transfer systems.

The Role of FrdD Subunit

  1. Accepting electrons from quinols in the membrane

  2. Transferring these electrons to the FrdB subunit

  3. Contributing to the generation of a transmembrane proton gradient

  4. Anchoring the catalytic components to the cell membrane

In A. succinogenes specifically, the FrdD subunit is part of a membrane-bound complex that enables the organism to couple fumarate reduction to succinate production, driving electron transfer and proton translocation across the cell membrane . This process is fundamental to the organism's energy metabolism and its ability to produce significant quantities of succinate during fermentation.

Enzymatic Properties and Activities

A. succinogenes possesses a highly active fumarate reductase system that is central to its metabolism. Cell membrane preparations from A. succinogenes have demonstrated high levels of benzyl viologen-linked fumarate reductase activity, measured at approximately 13.1 U . Interestingly, when neutral red (NR) is used as an electron carrier, fumarate reductase activity increases to 24.5 U, indicating that this electron mediator is particularly effective for the A. succinogenes FRD complex .

Role in Electron Transport and Energy Conservation

In A. succinogenes, the fumarate reductase complex, including the FrdD subunit, plays a critical role in energy conservation through the generation of a proton motive force. Experiments have demonstrated that proton translocation by whole cells of A. succinogenes is dependent on electron donors (either electrically reduced NR or H₂) and on fumarate concentration . This indicates that the FRD complex couples electron transfer to proton translocation across the membrane, generating an electrochemical gradient that can be used for ATP synthesis.

The FrdD subunit, as part of the membrane anchor domain, appears to function by replacing menaquinone (E₀' = −0.073 V) in the membrane-bound complex . This arrangement allows A. succinogenes to utilize electrical reducing power (via NR, E₀' = −0.325 V) to drive fumarate reduction and proton translocation during growth on glucose .

Expression Systems and Purification

Recombinant production of A. succinogenes FrdD involves heterologous expression in suitable host organisms. While specific information on the expression of A. succinogenes FrdD is limited in the search results, comparable approaches used for related Actinobacillus species provide insight into potential methods.

For instance, recombinant Fumarate reductase subunit D from Actinobacillus pleuropneumoniae has been successfully expressed in various host systems, including:

  • E. coli

  • Yeast

  • Baculovirus expression systems

  • Mammalian cell expression systems

  • Cell-free expression systems

Standard purification protocols typically yield protein preparations with purity levels greater than or equal to 85% as determined by SDS-PAGE analysis . These recombinant proteins serve as valuable tools for structural studies, biochemical characterization, and application development.

Challenges in Membrane Protein Expression

As a membrane protein, recombinant production of FrdD presents specific challenges compared to soluble proteins. The hydrophobic nature of membrane anchor subunits like FrdD can lead to protein misfolding, aggregation, or toxicity to the host cells during overexpression. Additionally, maintaining the proper structure and function of membrane proteins often requires specialized expression systems and purification techniques.

To overcome these challenges, researchers may employ strategies such as:

  1. Using specialized E. coli strains optimized for membrane protein expression

  2. Incorporating solubility tags or fusion partners

  3. Optimizing growth conditions to reduce toxicity

  4. Employing detergents during purification to maintain protein solubility and stability

Role in Succinic Acid Production

A. succinogenes is naturally capable of producing significant quantities of succinic acid (SA), making it an ideal candidate for industrial bioproduction of this valuable compound from renewable feedstocks . Succinic acid is an important platform chemical with applications in pharmaceuticals, food additives, and polymer production.

The fumarate reductase complex, including the FrdD subunit, plays a critical role in this production pathway by catalyzing the reduction of fumarate to succinate, the final step in the formation of succinic acid. Recent metabolic engineering efforts have focused on enhancing succinic acid production in A. succinogenes by manipulating various metabolic pathways .

Genetic Modifications and Pathway Engineering

Researchers have developed facile metabolic engineering capabilities in A. succinogenes to examine determinants of succinic acid flux. These approaches include:

  1. Knockout of competing pathways (acetate and formate production)

  2. Overexpression of key enzymes in the reductive branch of the TCA cycle leading to succinic acid

Results from batch fermentation experiments with engineered strains have demonstrated that overexpression of succinic acid biosynthetic machinery enhances flux to succinic acid. Additionally, removal of competitive carbon pathways leads to higher-purity succinic acid production .

Bioelectrochemical Applications

One particularly interesting application of A. succinogenes and its fumarate reductase system is in bioelectrochemical systems. Research has demonstrated that A. succinogenes can use electricity as a significant source of reducing power for growth and metabolism . This capability is mediated in part by the fumarate reductase complex, including the FrdD subunit.

Electrically reduced neutral red (NR) can serve as an electron donor for the fumarate reductase system, enabling A. succinogenes to couple electrical reducing power to fumarate reduction and proton translocation . This represents a novel approach to providing reducing equivalents for microbial metabolism and could have applications in bioelectrosynthesis of valuable compounds like succinic acid using electrical energy as an input.

Comparison with Other Fumarate Reductase Systems

While the catalytic subunits (FRDA and FRDB) tend to be highly conserved across species, the membrane anchor subunits (FRDC and FRDD) show greater variability . This variability likely reflects adaptations to different cellular environments and electron transfer systems, which may be particularly relevant for organisms like A. succinogenes that can utilize diverse electron donors, including electrical reducing power .

Species-Specific Adaptations

A. succinogenes has evolved specific adaptations in its fumarate reductase system that enable it to thrive in its ecological niche and produce high levels of succinic acid. These adaptations include:

  1. The ability to use diverse electron donors, including hydrogen and electrically reduced neutral red

  2. High levels of fumarate reductase activity compared to other redox enzymes

  3. Integration of the fumarate reductase system with proton translocation mechanisms for energy conservation

  4. Metabolic flexibility that allows for growth on different carbon sources while maintaining high succinic acid production

Understanding these species-specific adaptations provides insights into the evolution of bacterial energy metabolism and offers opportunities for biotechnological applications.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in your order notes, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. For dry ice shipping, please contact us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
frdD; Asuc_1816; Fumarate reductase subunit D; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Actinobacillus succinogenes (strain ATCC 55618 / 130Z)
Target Names
frdD
Target Protein Sequence
MINTNPKRSNEPPVWLLFSAGGMISALAFPVLILILGILLPLGIISPDGIIAFAHHWFGK LVILVLTIFPAWAGLHRIHHGMHDIKVHVPSGGLIFYGLAVLYTVVAIWGVASI
Uniprot No.

Target Background

Function
This protein anchors the catalytic components of the fumarate reductase complex to the cell membrane and binds quinones.
Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of fumarate reductase subunit D (frdD) in Actinobacillus succinogenes?

Fumarate reductase subunit D (frdD) in Actinobacillus succinogenes functions as part of the membrane anchor domain within the fumarate reductase complex (FRD). This complex, encoded by the frdABCD operon, catalyzes the conversion of fumarate to succinate. The complete FRD enzyme consists of four non-identical subunits arranged in two functional domains: (1) the FRDAB catalytic domain and (2) the FRDCD membrane anchor domain. The FRDD subunit, together with FRDC, is essential for electron transfer and proton translocation reactions involving menaquinone, which are coupled to the generation of a transmembrane proton gradient used by the organism to support growth and metabolic function .

The membrane anchor domain where frdD resides is particularly critical for the organism's energy metabolism during anaerobic respiration, as it enables A. succinogenes to utilize fumarate as a terminal electron acceptor when oxygen is unavailable. This capability is central to A. succinogenes' identity as one of the best natural succinate-producing organisms .

How does fumarate reductase in A. succinogenes compare structurally and functionally to that in other model organisms?

The fumarate reductase complex in A. succinogenes shares significant structural and functional homology with those found in other anaerobic and facultative anaerobic bacteria such as Escherichia coli and Wolinella succinogenes. In all these organisms, the enzyme catalyzes the fumarate-dependent oxidation of menaquinone coupled to proton translocation across the membrane .

Key similarities and differences include:

CharacteristicA. succinogenes FRDE. coli FRDNotes
Subunit compositionFour subunits: FRDA, FRDB, FRDC, FRDDFour subunits: FRDA, FRDB, FRDC, FRDDConserved quaternary structure
Domain organizationFRDAB (catalytic) and FRDCD (membrane anchor)FRDAB (catalytic) and FRDCD (membrane anchor)Consistent functional domains
Enzymatic activityHigh benzyl viologen-linked activity (13.1 U)Lower activityA. succinogenes shows particularly high fumarate reductase activity
Electron donorsCan use electrically reduced neutral redPrimarily uses menaquinoneA. succinogenes shows adaptability to alternative electron sources

The unique properties of A. succinogenes FRD, particularly its high activity and adaptability to different electron donors, contribute to this organism's exceptional succinate production capabilities compared to other bacterial species .

What genetic and protein sequence characteristics define the frdD gene and its product?

The frdD gene in A. succinogenes encodes the smallest subunit of the fumarate reductase complex. While the search results don't provide the exact sequence information, research methodology for characterizing frdD would typically include:

  • Gene sequence analysis through PCR amplification and sequencing of the frdD locus

  • Protein sequence determination using mass spectrometry of the purified subunit

  • Hydrophobicity profile analysis, which would likely reveal multiple transmembrane domains consistent with its role as part of the membrane anchor

  • Conserved domain searches to identify functional motifs associated with quinone binding and interaction with other FRD subunits

Researchers interested in frdD characterization should conduct comparative sequence analysis with homologous proteins from related organisms, particularly focusing on conserved residues that might participate in menaquinone binding or protein-protein interactions with the FRDC subunit .

What methods are effective for generating recombinant A. succinogenes strains with modified frdD?

Creating recombinant A. succinogenes strains with modified frdD can be accomplished through several approaches, with the markerless knockout method being particularly effective. Based on the research by Guettler and colleagues, the following methodology is recommended:

  • Construct design: Create a knockout construct containing:

    • Homologous regions flanking the frdD gene (minimum 200 bp for efficient recombination)

    • A positive selection marker (e.g., E. coli isocitrate dehydrogenase gene) flanked by FRT sites

    • Total of approximately 1 kb of DNA on each side of the selection cassette to protect from exonuclease activity

  • Transformation methods:

    • Natural transformation or electroporation (efficiency of 10⁴ to 10⁶ CFU/μg plasmid)

    • For electroporation, use the shuttle vector pLGZ920 which replicates in both A. succinogenes and E. coli

  • Selection strategy:

    • Utilize A. succinogenes' auxotrophy for glutamate to select transformants on media containing isocitrate

    • This exploits the E. coli isocitrate dehydrogenase gene as a positive selection marker

  • Marker removal:

    • Express the Saccharomyces cerevisiae flippase recombinase (Flp) to remove the selection marker

    • This allows marker reuse for sequential genetic modifications

This methodology has been successfully demonstrated for other genes in the frd operon and can be adapted specifically for frdD modifications .

What are the optimal expression conditions for recombinant frdD in A. succinogenes?

Optimal expression of recombinant frdD in A. succinogenes requires careful control of growth conditions and gene expression systems. Based on the available research, the following parameters should be considered:

  • Expression vector selection:

    • Use pLGZ920 vector, which allows high-level expression of foreign genes under the control of the strong, constitutive A. succinogenes pckA promoter

    • This vector confers ampicillin resistance and replicates in both A. succinogenes and E. coli

  • Growth medium components:

    • Adjust glucose concentration based on desired growth phase and expression timing (optimal initial concentration varies, but approximately 20-40 g/L may be ideal based on growth profiles)

    • Include yeast extract as a nitrogen source

    • Add magnesium carbonate as a buffer to control pH during fermentation

    • Note that interactive effects between yeast extract and magnesium carbonate have been shown to be statistically significant

  • Culture conditions:

    • Maintain strict anaerobic conditions under N₂ atmosphere

    • Control pH to approximately 6.8-7.2 using appropriate buffer systems

    • Optimize temperature at approximately 37°C (standard for A. succinogenes cultivation)

  • Harvest timing:

    • For maximum protein yield, harvest cells during mid to late exponential phase (approximately 16 hours of growth)

    • Process cells rapidly under anaerobic conditions to preserve enzyme activity

These parameters can be fine-tuned using response surface methodology (RSM) and central composite design (CCD) as demonstrated for optimizing related fermentation processes in A. succinogenes .

What purification methods yield the highest activity for recombinant frdD protein?

Purification of recombinant frdD protein from A. succinogenes requires specialized techniques due to its membrane-bound nature. The following methodology is recommended based on established protocols for membrane protein purification:

  • Cell disruption and membrane isolation:

    • Harvest cells by centrifugation (5,000 × g for 30 minutes) at 4°C

    • Wash cells three times with 50 mM Na phosphate buffer (pH 7.2) containing 1 mM dithiothreitol (DTT)

    • Disrupt cells by sonication or French press under anaerobic conditions

    • Separate membrane fraction by ultracentrifugation (typically 100,000 × g for 1 hour)

  • Membrane protein solubilization:

    • Treat membrane fraction with appropriate detergents (e.g., n-dodecyl-β-D-maltoside or digitonin)

    • Include protease inhibitors to prevent degradation

    • Maintain reducing conditions with DTT or β-mercaptoethanol

  • Chromatographic purification:

    • Use affinity chromatography if the recombinant protein contains a fusion tag

    • For native protein, employ ion exchange chromatography followed by gel filtration

    • Perform all purification steps under anaerobic conditions to maintain enzyme activity

  • Activity preservation:

    • Include stabilizing agents such as glycerol (10-20%) in storage buffers

    • Maintain protein in buffer containing 50 mM sodium phosphate with 2 mM DTT

    • Store purified protein at -80°C in small aliquots to avoid repeated freeze-thaw cycles

  • Activity assay:

    • Measure fumarate reductase activity using benzyl viologen or neutral red as electron donors

    • Standardize assay conditions: 50 mM phosphate buffer, pH 7.2, anaerobic conditions, 30°C

    • Activity can be expressed in units (U), where 1 U equals the amount of enzyme that catalyzes the reduction of 1 μmol of fumarate per minute

This purification protocol should yield membrane protein fractions with high fumarate reductase activity (approximately 13.1 U with benzyl viologen and 24.5 U with neutral red as electron carriers) .

How does modification of frdD affect electron transport and energy metabolism in A. succinogenes?

  • Altered electron carrier interactions:

    • The frdD subunit appears to interact directly with menaquinone in the membrane; modifications can alter this interaction efficiency

    • Studies with neutral red (NR) suggest that this artificial electron carrier can bypass normal electron transport chains when frdD functionality is altered, potentially replacing menaquinone in the fumarate reductase complex

    • In wild-type A. succinogenes, the rate of fumarate reduction to succinate by purified membranes was twofold higher with electrically reduced NR than with hydrogen as the electron donor

  • Impact on proton translocation:

    • Modifications affecting the proton channel aspects of frdD can directly impact the generation of proton motive force

    • Proton translocation by whole cells is dependent on electron donor availability and fumarate concentration

    • The addition of 2-(n-heptyl)-4-hydroxyquinoline N-oxide inhibits succinate production from H₂ plus fumarate but not from electrically reduced NR plus fumarate, suggesting alternate electron pathways that could be enhanced through frdD engineering

  • Metabolic pathway redistribution:

    • When alternative electron transport mechanisms are enabled through frdD modification, metabolic flux changes are observed

    • In experimental systems using electrically reduced NR, glucose consumption and growth increased by approximately 20% while acetate production decreased by about 50%

    • This suggests that redirecting electron flow through engineered frdD variants could potentially improve succinate yields by altering the NADH/NAD⁺ ratio and subsequent carbon flux distributions

These findings indicate that targeted modifications of frdD could be leveraged to optimize electron transport for enhanced succinate production or to enable utilization of alternative electron sources.

What strategies exist for engineering frdD to enhance succinate production?

Several strategic approaches for engineering frdD to enhance succinate production in A. succinogenes have emerged from recent research:

  • Structure-guided mutagenesis:

    • Target specific amino acid residues in frdD involved in menaquinone binding

    • Modify residues at the interface between frdD and other subunits to optimize electron transfer efficiency

    • Engineer proton channel aspects to enhance proton translocation coupled to fumarate reduction

  • Alternative electron acceptor adaptation:

    • Engineer frdD to more efficiently utilize alternative electron carriers such as neutral red

    • This approach could enable electricity-driven succinate production as demonstrated in experiments where electrically reduced NR enhanced glucose consumption and succinate production by approximately 20%

  • Genomic context modifications:

    • Implement markerless knockouts of competing pathways (e.g., pyruvate formate lyase encoded by pflB) while maintaining or enhancing frdD function

    • Pyruvate formate lyase knockout mutations increase succinate production, suggesting synergistic effects when combined with optimized frdD

  • Genome shuffling approaches:

    • Employ genome shuffling techniques that have successfully improved acid tolerance and succinate production in A. succinogenes

    • One modified strain (AS-F32) produced 31.2 g/L of succinic acid, 1.1 times more than the original strain

    • While not specifically targeting frdD, this approach could be focused on regions containing the frd operon

  • Mathematical modeling for optimization:

    • Develop process-based dynamic models to predict optimal conditions for strains with modified frdD

    • Experimental data shows complex relationships between glucose concentration, growth, and acid production that could guide frdD engineering efforts

Engineering StrategyPotential ImprovementTechnical ComplexityReference
Structure-guided mutagenesisEnhanced electron transfer efficiencyHigh
Alternative electron acceptor adaptationElectricity-driven production (+20%)Medium
Genomic context modificationsSynergistic pathway optimizationMedium
Genome shufflingImproved acid tolerance and productionMedium-High
Mathematical modelingOptimized process parametersLow

These strategies can be employed individually or in combination to create optimized A. succinogenes strains with enhanced succinate production capabilities.

How can recombinant frdD be utilized to adapt A. succinogenes to alternative carbon sources?

Recombinant engineering of frdD offers promising approaches for adapting A. succinogenes to utilize alternative carbon sources more efficiently, expanding the substrate range for succinate production:

  • Electron transport chain adaptations:

    • Modifications to frdD can alter the electron carrier interactions, potentially allowing better coupling with electron transport chains that are active during metabolism of alternative carbon sources

    • The ability of modified fumarate reductase complexes to interact with alternative electron carriers (as demonstrated with neutral red) suggests potential for adaptation to different metabolic contexts

  • Redox balance optimization:

    • Different carbon sources create distinct intracellular redox environments

    • Engineered frdD variants could help maintain optimal redox balance during metabolism of substrates with different oxidation states

    • This approach could be particularly valuable for adapting A. succinogenes to lignocellulosic hydrolysates or glycerol, which present different redox challenges than glucose

  • Co-factor specificity adjustments:

    • Modify frdD to alter the interaction between the fumarate reductase complex and electron carriers

    • This could potentially allow the enzyme to function more efficiently with the co-factor ratios that prevail during metabolism of alternative carbon sources

  • Integration with carbon flux optimization:

    • Combine frdD engineering with modifications to central carbon metabolism

    • For example, when using substrates that enter metabolism through different pathways than glucose, coordinated optimization of both carbon flux and electron transport through frdD modifications could maximize succinate yields

  • Stress tolerance mechanisms:

    • Alternative carbon sources often introduce additional stresses (inhibitors, pH fluctuations)

    • Engineering frdD in conjunction with membrane composition modifications could enhance tolerance to these stresses

    • Genome shuffling approaches that improved acid tolerance in A. succinogenes demonstrate the potential for developing more robust strains

The development of these adaptive strategies should be guided by mathematical modeling and experimental validation using response surface methodology (RSM) to identify optimal conditions for each carbon source . This systematic approach would enable researchers to develop specialized A. succinogenes strains optimized for specific industrial feedstocks.

What are the current limitations in studying and expressing recombinant frdD?

Several significant challenges currently limit the study and expression of recombinant frdD in A. succinogenes:

Addressing these limitations will require interdisciplinary approaches combining advanced molecular biology techniques, membrane protein biochemistry, and systems biology perspectives.

How might CRISPR/Cas9 and other emerging technologies advance frdD engineering?

The application of CRISPR/Cas9 and other cutting-edge technologies offers transformative potential for frdD engineering in A. succinogenes:

  • CRISPR/Cas9 genome editing:

    • Enables precise modifications at the frdD locus without requiring selection markers

    • Allows for simultaneous editing of multiple genomic targets, facilitating systems-level optimization

    • Can be used to create allelic series of frdD variants with graduated functional changes

    • Implementation strategy:

      1. Design sgRNAs targeting specific regions of frdD

      2. Create repair templates containing desired mutations

      3. Optimize Cas9 expression for A. succinogenes

      4. Screen transformants using high-throughput phenotyping

  • Next-generation sequencing applications:

    • RNA-Seq analysis can reveal transcriptional responses to frdD modifications

    • Genome-wide fitness profiling (Tn-Seq) can identify genetic interactions with frdD

    • Implementation approach:

      1. Create libraries of frdD variants

      2. Apply selection pressure (e.g., growth with alternative electron acceptors)

      3. Use NGS to identify enriched variants

  • Synthetic biology approaches:

    • Modular design principles can be applied to create chimeric fumarate reductase complexes

    • Orthogonal translation systems could enable incorporation of non-canonical amino acids at key positions in frdD

    • Implementation strategy:

      1. Design synthetic frdD variants with modular functional domains

      2. Engineer genetic circuits for conditional expression

      3. Apply directed evolution to optimize novel functions

  • Structural biology integration:

    • Cryo-EM and computational modeling can provide structural insights to guide frdD engineering

    • Molecular dynamics simulations can predict effects of specific mutations

    • Implementation approach:

      1. Generate structural models of A. succinogenes fumarate reductase

      2. Identify critical residues for function

      3. Design mutations predicted to enhance desired properties

  • High-throughput screening platforms:

    • Microfluidic systems can enable rapid screening of frdD variants

    • Biosensors for succinate or redox state can accelerate strain evaluation

    • Implementation strategy:

      1. Develop fluorescent or colorimetric assays for fumarate reductase activity

      2. Create screening platforms compatible with anaerobic conditions

      3. Apply machine learning to optimize screening parameters

These technologies, while not yet widely applied to A. succinogenes, represent the frontier of possibilities for frdD engineering and could dramatically accelerate research progress in this field.

What interdisciplinary approaches might resolve current research challenges with recombinant frdD?

Resolving the complex challenges associated with recombinant frdD research requires innovative interdisciplinary approaches that integrate multiple scientific disciplines:

  • Systems biology and metabolic engineering integration:

    • Combine genome-scale metabolic models with protein engineering to predict system-wide effects of frdD modifications

    • Use 13C metabolic flux analysis to quantify changes in electron and carbon flow

    • Develop dynamic models that capture temporal aspects of metabolism following frdD alterations

    • Implementation strategy:

      1. Create genome-scale models incorporating electron transport chains

      2. Validate predictions with experimental data from modified strains

      3. Iteratively refine models based on experimental outcomes

  • Membrane biology and protein engineering synergy:

    • Apply principles from membrane protein biophysics to improve frdD stability and activity

    • Engineer synthetic membrane environments for optimized fumarate reductase function

    • Implementation approach:

      1. Characterize lipid-protein interactions affecting fumarate reductase

      2. Design membrane-mimetic systems for in vitro studies

      3. Apply directed evolution in defined membrane environments

  • Bioelectrochemistry and synthetic electron transport:

    • Expand on findings regarding electrically reduced neutral red

    • Develop novel electrode materials and configurations for bioelectrochemical systems

    • Create synthetic electron transport pathways interfacing with frdD

    • Implementation strategy:

      1. Design bioelectrodes compatible with A. succinogenes physiology

      2. Engineer frdD variants optimized for direct electron transfer

      3. Develop scalable bioelectrochemical reactors

  • Computational biology and artificial intelligence:

    • Apply machine learning to predict optimal frdD sequences for specific functions

    • Use molecular simulations to understand electron transfer mechanisms

    • Develop computational models for protein-protein and protein-membrane interactions

    • Implementation approach:

      1. Generate training datasets from libraries of frdD variants

      2. Develop ML algorithms to predict function from sequence

      3. Apply computational design to generate novel frdD variants

  • Process engineering and bioreactor design:

    • Develop specialized bioreactor configurations for strains with modified frdD

    • Optimize process parameters using response surface methodology

    • Create integrated systems combining fermentation with electrochemical components

    • Implementation strategy:

      1. Design bioreactors with controlled redox environments

      2. Optimize medium composition for specific frdD variants

      3. Scale up promising laboratory findings to pilot scale

These interdisciplinary approaches could synergistically address current limitations while opening new avenues for fundamental discoveries and practical applications in recombinant frdD research.

How should researchers design experiments to evaluate the impact of frdD mutations?

Designing rigorous experiments to evaluate frdD mutations requires careful consideration of numerous factors. The following structured approach is recommended:

  • Mutation strategy design:

    • Employ site-directed mutagenesis targeting specific functional regions:

      • Transmembrane domains

      • Putative quinone binding sites

      • Subunit interaction interfaces

    • Create both conservative (similar amino acid properties) and non-conservative mutations

    • Include controls:

      • Silent mutations (same amino acid, different codon)

      • Mutations in non-conserved regions

  • Expression system optimization:

    • Use the pLGZ920 vector with the strong constitutive A. succinogenes pckA promoter

    • Create an inducible expression system if tight regulation is needed

    • Express wild-type frdD alongside mutants for direct comparison

    • Implement epitope tagging if antibodies to native frdD are unavailable

  • Phenotypic characterization protocol:

    • Growth profiling:

      • Measure growth rates under various conditions (carbon sources, electron acceptors)

      • Determine minimum inhibitory concentrations of relevant stress factors

    • Metabolite analysis:

      • Quantify succinate, acetate, and formate production over time

      • Measure glucose consumption rates

      • Calculate carbon recovery and electron balances

  • Biochemical assays:

    • Membrane preparation protocol:

      • Harvest cells during exponential phase

      • Prepare membranes under anaerobic conditions

      • Standardize protein content across samples

    • Activity measurements:

      • Assay fumarate reductase activity with multiple electron donors (benzyl viologen, neutral red)

      • Determine enzyme kinetic parameters (Km, Vmax)

      • Measure activity under varying pH and temperature conditions

  • Advanced analytical approaches:

    • Proteoliposome reconstitution to assess proton translocation

    • Protein crosslinking to evaluate subunit interactions

    • Differential scanning calorimetry to assess protein stability

    • Spectroscopic methods to examine electron transfer events

  • Data analysis framework:

    • Apply appropriate statistical methods (ANOVA, regression analysis)

    • Use response surface methodology to identify optimal conditions

    • Develop mathematical models to interpret complex phenotypes

This experimental design framework enables comprehensive evaluation of frdD mutations with appropriate controls and multiple levels of analysis to establish structure-function relationships.

What experimental controls are critical for validating recombinant frdD function?

Robust validation of recombinant frdD function requires carefully designed experimental controls at multiple levels:

  • Genetic controls:

    • Wild-type reference: Include the unmodified A. succinogenes strain in all experiments

    • Empty vector control: Transform cells with the expression vector lacking the frdD insert

    • Complementation control: Restore wild-type frdD in knockout strains to verify phenotype reversal

    • Marker effect control: Create strains with marker insertion in neutral genomic locations

  • Expression validation controls:

    • Transcript level verification: Use RT-PCR to confirm frdD expression

    • Protein detection: Implement Western blotting with epitope tags or antibodies

    • Localization control: Verify membrane localization using fractionation techniques

    • Assembly verification: Confirm integration into the fumarate reductase complex

  • Functional assay controls:

    • Enzyme inhibitor controls: Use specific inhibitors like 2-(n-heptyl)-4-hydroxyquinoline N-oxide

    • Alternative substrate controls: Test activity with structural analogs of fumarate

    • Electron donor specificity: Compare activity with multiple electron donors (benzyl viologen, neutral red, hydrogen)

    • Temperature and pH controls: Establish activity profiles under varying conditions

  • Metabolic controls:

    • Carbon source variation: Test function with different substrates

    • Anaerobiosis verification: Include oxygen indicators in growth media

    • Metabolic pathway inhibitors: Use specific inhibitors to verify pathway contributions

    • Redox state indicators: Monitor NAD⁺/NADH ratios to track metabolic state

  • Technical methodology controls:

    • Process controls: Include standards in all analytical procedures

    • Biological replicates: Perform experiments with multiple independent transformants

    • Technical replicates: Repeat critical measurements to ensure reproducibility

    • Randomization: Design experiments to avoid systematic bias

Control TypePurposeImplementation Method
GeneticEstablish baseline and specificityInclude wild-type and empty vector strains
ExpressionVerify proper synthesis and localizationRT-PCR and Western blotting
FunctionalValidate enzymatic activityMultiple electron donors and inhibitors
MetabolicConfirm physiological relevanceTest under various growth conditions
TechnicalEnsure reproducibilityReplicate experiments with appropriate standards

Implementation of this comprehensive control framework ensures that observed phenotypes can be specifically attributed to the recombinant frdD rather than to experimental artifacts or secondary effects.

What data analysis methods best capture the complex phenotypes resulting from frdD modifications?

Analyzing the multifaceted phenotypes resulting from frdD modifications requires sophisticated data analysis approaches that can capture complex relationships and emergent properties:

  • Multivariate statistical methods:

    • Principal Component Analysis (PCA): Reduce dimensionality of complex phenotypic data

    • Partial Least Squares Regression (PLS): Relate frdD sequence variations to phenotypic outcomes

    • Hierarchical Clustering: Group similar phenotypes to identify patterns

    • Implementation approach:

      1. Collect multiple phenotypic measurements for each strain

      2. Normalize data appropriately across measurement types

      3. Apply multivariate methods to identify key relationships

  • Time-series analysis techniques:

    • Dynamic flux balance analysis: Model metabolic shifts over time

    • Growth curve parameter extraction: Derive lag phase, exponential growth rate, and carrying capacity

    • Metabolite production kinetics: Fit production rates to appropriate models

    • Implementation approach:

      1. Collect time-course data for growth and metabolite production

      2. Apply appropriate mathematical models to extract parameters

      3. Compare parameters across strains and conditions

  • Response surface methodology (RSM):

    • Central composite design (CCD): Systematically explore condition space

    • ANOVA-based analysis: Identify significant factors and interactions

    • Predictive modeling: Generate empirical models of system behavior

    • Implementation approach:

      1. Design experiments with factorial variation of key parameters

      2. Analyze variance to identify significant effects

      3. Develop predictive models for optimization

  • Pathway and network analysis:

    • Metabolic control analysis: Quantify control coefficients for modified enzymes

    • Flux balance analysis: Model whole-cell metabolic impacts

    • Regulatory network inference: Identify compensatory responses

    • Implementation approach:

      1. Measure flux distributions using 13C labeling

      2. Apply metabolic models to interpret changes

      3. Identify regulatory responses through transcriptomics

  • Machine learning approaches:

    • Random forest classifiers: Identify key features distinguishing phenotypes

    • Support vector machines: Classify strains based on phenotypic profiles

    • Neural networks: Develop predictive models for complex phenotypes

    • Implementation approach:

      1. Generate training datasets from multiple frdD variants

      2. Train models on phenotypic data

      3. Validate predictions with new variants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.