Recombinant Actinobacillus succinogenes Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Actinobacillus succinogenes Large-Conductance Mechanosensitive Channel (MscL)

The mechanosensitive channel of large conductance (MscL) in bacteria functions as an emergency valve, releasing cytoplasmic solutes when the cell experiences osmotic stress . Inappropriate opening of MscL's large pore can harm the cell, leading to speculation that it could be a potential target for antibiotics . Actinobacillus succinogenes is a Gram-negative, facultative anaerobe, notable for its capacity to convert sugars into succinic acid, a valuable intermediary feedstock in chemical productions .

Significance of MscL in Actinobacillus succinogenes

Actinobacillus succinogenes exhibits a native ability to transform pentose and hexose sugars into succinic acid (SA) . It incorporates CO$$_2$$ into SA, which positions the organism as a suitable candidate for converting lignocellulosic sugars and CO$$_2$$ into a bioproduct . MscL's role in this bacterium is crucial for maintaining cellular integrity under osmotic stress, preventing cell damage or death caused by sudden changes in external osmolarity.

MscL as an Antibacterial Target

MscL is present in most bacterial species, including pathogens, making it a potential antibacterial target . Recent studies have identified small compounds that bind to and open the channel, leading to decreased cell growth and viability .

Research Findings on MscL Modulators

A high-throughput screen identified two sulfonamide compounds that slowed growth in an MscL-dependent manner . One compound does not work through the folate pathway and its sulfonamide portion isn't needed for activity; its only mode of action appears to be MscL activation .

Functional Analysis of MscL

Patch clamp experiments have been used to study the activity of MscL at the single-channel level . MscL channel activity increased significantly when compounds were presented from either the periplasmic or cytoplasmic side of the membrane .

Novel MscL Agonists

In silico screening has led to the discovery of a new family of compounds, distinct from other known MscL-specific agonists . These findings suggest that MscL could be a viable drug target for bacterial infections that are difficult to treat .

MscL-Targeting Antibiotics

Compound 10 was specifically designed as a ligand for MscL . The antimicrobial activity of 10 is a consequence of its interaction with the MscL channel .

Metabolic Engineering of Actinobacillus succinogenes

Metabolic engineering has enabled the examination of SA flux determinants via knockout of primary competing pathways and overexpression of key enzymes in the reductive branch of the TCA cycle leading to SA .

Succinic Acid Production

Actinobacillus succinogenes is the first choice for succinic acid production because it produces a high amount of succinic acid, uses cheap carbon sources, performs well in scalable biorefinery streams, resists high concentrations of glucose, has high CO$$_2$$ availability, is non-pathogenic, and tolerates impurities in hydrolysate . By combining fermentation with bioelectrochemical systems (BES), sustainable succinic acid production and CO$$_2$$ fixation could be achieved using Actinobacillus .

Data Table Summarizing MscL Research

CategoryDescription
MscL FunctionFunctions as an emergency release valve, discharging cytoplasmic solutes upon osmotic stress .
Antibiotic TargetMscL is considered a potential antibiotic target because its inappropriate opening is detrimental to the cell .
MscL ModulatorsSulfonamide compounds can modulate MscL, increasing its gating activity .
Patch Clamp ExperimentsUsed to measure MscL channel activity, showing increased open probability with certain compounds .
Novel AgonistsIn silico screening identified new compounds that act as MscL agonists, suggesting a viable drug target .
Antibiotic Compound 10Designed as a ligand for MscL, its antimicrobial activity depends on interaction with the MscL channel .
Metabolic EngineeringUsed to improve succinic acid production by modifying metabolic pathways in Actinobacillus succinogenes .
Succinic Acid ProductionActinobacillus succinogenes is favored for succinic acid production due to its efficiency and tolerance to various conditions .
CO$$_2$$ IncorporationActinobacillus succinogenes incorporates CO$$_2$$ into succinic acid, making it ideal for bioproduct conversion .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
mscL; Asuc_0245; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Actinobacillus succinogenes (strain ATCC 55618 / 130Z)
Target Names
mscL
Target Protein Sequence
MSFIKEFREFAMRGNVVDMAVGVIIGGAFGKIVSSLVGDVVMPVLGILTGGVDFKDMKMV LAEAVGETPAVTLNYGMFIQNVFDFIIIAFAIFLMIKAINKLKKPAEEAPKGPSQEELLA EIRDLLKK
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating intracellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Actinobacillus succinogenes and why is it important in biotechnology research?

Actinobacillus succinogenes is a Gram-negative, capnophilic (CO₂-loving), facultatively anaerobic, biofilm-forming bacterium with exceptional capacity to convert various carbon sources to succinic acid as its primary fermentation product . This organism has gained significant attention in industrial biotechnology for several reasons:

  • It possesses a unique incomplete TCA cycle that naturally terminates at succinic acid

  • It achieves among the highest reported succinic acid titers and yields in the literature

  • It efficiently utilizes both hexose and pentose sugars, including glucose, xylose, arabinose, and mannose

  • It can metabolize lignocellulosic biomass components, supporting biorefinery applications

  • It fixes CO₂ during fermentation, contributing to carbon-neutral bioprocesses

The metabolic characteristics of A. succinogenes make it an ideal platform organism for sustainable succinic acid production from renewable feedstocks, positioning it as a valuable alternative to petroleum-based chemical synthesis routes.

What are mechanosensitive channels and what specific function does MscL serve?

Mechanosensitive channels are membrane protein complexes that respond to mechanical tension in the cell membrane by forming pores. The large-conductance mechanosensitive channel (MscL) is one of the primary types that serves as an emergency release valve during hypoosmotic shock . Its functions include:

  • Opening in response to increased membrane tension during hypoosmotic shock, preventing cell lysis

  • Allowing rapid efflux of cytoplasmic solutes and water when activated

  • Contributing to osmotic adaptation, particularly with sodium ions (demonstrated in related Actinobacillus species)

  • Potentially playing roles in antibiotic resistance mechanisms

  • Contributing to biofilm formation in some Actinobacillus species

MscL channels are highly conserved across bacterial species, suggesting their fundamental importance in bacterial physiology and stress responses. In A. pleuropneumoniae (a related species), MscL has been shown to influence cell length regulation during osmotic adaptation .

What genetic engineering tools are available for manipulating A. succinogenes?

Several genetic tools have been developed specifically for A. succinogenes that enable recombinant protein expression and metabolic engineering:

  • Plasmid vectors: Modified vectors capable of replication in A. succinogenes, including shuttle vectors compatible with both E. coli and A. succinogenes

  • Selectable markers: Antibiotic resistance genes functional in A. succinogenes, including those conferring resistance to:

    • Kanamycin (50 μg/mL)

    • Tetracycline (10 μg/mL)

    • Chloramphenicol (34 μg/mL)

  • Promoter systems:

    • Characterized set of 22 constitutive promoters showing a 260-fold range of expression levels

    • The Anderson promoter collection has been characterized in A. succinogenes with BBa_J23100 showing the strongest expression

  • Inducible systems:

    • A modified lac promoter system with 481-fold dynamic range

    • Systems based on the core lac promoter have been demonstrated to function in A. succinogenes

  • Homologous recombination tools: Linear DNA fragments with homology regions enable chromosomal integration and gene disruption

  • Cre-loxP systems: Allow for antibiotic marker removal and recycling for multiple genetic modifications

These tools provide researchers with a comprehensive toolkit for genetic manipulation of A. succinogenes, enabling gene knockouts, heterologous gene expression, and pathway engineering.

What growth media formulations are optimal for cultivating recombinant A. succinogenes strains?

Several media formulations have been optimized for A. succinogenes cultivation depending on the research objectives:

Complex media for routine cultivation:

  • Tryptic Soy Broth supplemented with yeast extract (10-15 g/L) supports robust growth

  • Optimized production media containing glucose (80-85 g/L), yeast extract (14-15 g/L), and MgCO₃ (65 g/L) has been shown to maximize succinic acid production

Defined media for controlled experiments:

  • AM3 medium: A phosphate-buffered defined medium containing:

    • Vitamins and minerals

    • NH₄Cl as the primary nitrogen source

    • Glutamate, cysteine, and methionine as required amino acids

    • This defined medium enables more controlled experimental conditions for metabolic studies

Carbon source considerations:

  • A. succinogenes efficiently utilizes glucose, xylose, arabinose, and mannose, with glucose showing the highest succinate yield (0.56 g/g)

  • The organism shows varying yield coefficients depending on the sugar source: glucose (0.56 g/g), xylose (0.42 g/g), arabinose (0.44 g/g), and mannose (0.38 g/g)

Buffer considerations:

  • MgCO₃ serves both as a CO₂ source and pH buffer

  • NaHCO₃ at concentrations of approximately 25 mM has been shown to support optimal growth rates by enabling both succinic acid and formate/acetate metabolic branches

For recombinant strains, media should be supplemented with appropriate antibiotics for plasmid maintenance based on the selection markers used in the expression system.

What methods can be used to clone and express the MscL gene from A. succinogenes?

Cloning and expressing the MscL gene from A. succinogenes involves several methodological steps:

Gene identification and analysis:

  • Identify the MscL homolog in the A. succinogenes genome using BLAST searches with MscL sequences from related organisms

  • Analyze the genomic context and predicted protein structure to confirm gene identity

PCR amplification:

  • Design primers with appropriate restriction sites flanking the MscL coding sequence

  • Extract genomic DNA from A. succinogenes using standard protocols

  • Perform PCR using high-fidelity DNA polymerase to minimize mutation risk

Cloning strategies:

  • Restriction enzyme-based cloning into expression vectors compatible with A. succinogenes

  • Gibson Assembly for seamless cloning without restriction site scars

  • Consider codon optimization if expressing in heterologous hosts

Expression vector selection:

  • For constitutive expression, vectors containing the BBa_J23100 promoter show the highest expression levels in A. succinogenes

  • For controlled expression, modified lac promoter systems provide inducible control with a 481-fold dynamic range

  • Include appropriate antibiotic resistance markers (kanamycin, tetracycline, or chloramphenicol)

Expression verification methods:

  • Western blotting using antibodies against MscL or epitope tags

  • Functional complementation assays in MscL-deficient strains

  • Membrane fractionation to confirm proper localization

  • RT-qPCR to verify transcription levels

For membrane proteins like MscL, expression conditions may need optimization, including temperature reduction during induction to improve proper membrane insertion and folding.

How does the MscL channel contribute to osmotic stress tolerance in A. succinogenes?

Based on studies in related bacteria including A. pleuropneumoniae, MscL likely plays a crucial role in osmotic stress response in A. succinogenes through several mechanisms:

Hypoosmotic shock protection:

  • MscL functions as a pressure-release valve during sudden decreases in external osmolarity

  • Channel opening allows rapid efflux of cytoplasmic solutes when membrane tension reaches critical thresholds

  • This prevents cell lysis under extreme osmotic downshock conditions

Cell morphology regulation:

  • In A. pleuropneumoniae, MscL has been shown to regulate cell length during osmotic adaptation to sodium stress

  • This morphological regulation may help maintain appropriate surface-to-volume ratios during osmotic fluctuations

Experimental approaches to characterize MscL's osmotic function:

  • Generate MscL knockout strains using homologous recombination techniques developed for A. succinogenes

  • Perform comparative growth studies under varying osmotic conditions

  • Microscopic analysis of cell morphology changes during osmotic shifts

  • Fluorescent dye-based assays to monitor solute efflux during hypoosmotic shock

Industrial relevance:

  • During fermentation, osmotic conditions change as substrates are consumed and products accumulate

  • Understanding MscL function could help develop more robust industrial strains

  • Engineered MscL variants might improve tolerance to high product concentrations

The function of MscL in osmotic adaptation is particularly relevant for succinic acid production, as high titers create significant osmotic stress that can limit productivity in industrial fermentations.

What is the relationship between MscL function and antibiotic resistance in Actinobacillus species?

Studies in A. pleuropneumoniae have revealed important connections between MscL and antibiotic resistance that may be relevant to A. succinogenes:

Experimental findings in related Actinobacillus species:

  • Deletion of MscL in A. pleuropneumoniae altered susceptibility to multiple antibiotics

  • MscL deletion decreased sensitivity to some antibiotics while increasing sensitivity to others

  • Specifically, MscL contributed to resistance against chloramphenicol, erythromycin, and penicillin

Potential mechanisms:

  • MscL channels may facilitate the entry of certain antibiotics, particularly aminoglycosides

  • Channel activity might influence membrane permeability properties

  • MscL may interact with other resistance mechanisms or efflux systems

Research approaches to investigate this relationship in A. succinogenes:

  • Generate MscL knockout and overexpression strains

  • Perform minimum inhibitory concentration (MIC) assays with various antibiotic classes

  • Measure antibiotic uptake kinetics using fluorescently labeled compounds

  • Combine MscL modifications with known resistance mechanisms

Practical applications:

  • Understanding MscL's role in antibiotic resistance could help design better selection markers for genetic engineering

  • This knowledge could improve contamination control strategies in industrial fermentations

  • MscL variants could potentially be engineered as selectable markers with novel properties

This relationship between MscL and antibiotic resistance represents an important consideration for strain development and could provide new insights into membrane-based resistance mechanisms.

What role does MscL play in biofilm formation in Actinobacillus species?

Research in A. pleuropneumoniae has demonstrated that MscL contributes significantly to biofilm formation , suggesting similar functions may exist in A. succinogenes:

Experimental evidence:

  • MscL deletion in A. pleuropneumoniae resulted in decreased biofilm formation capability

  • This suggests MscL plays a positive regulatory role in biofilm development

Potential mechanisms:

  • MscL may influence cell surface properties that affect initial attachment

  • Channel activity could impact signaling pathways involved in biofilm maturation

  • Osmoregulation functions might contribute to biofilm matrix formation

  • MscL might affect cell-to-cell communication within biofilms

Research approaches for A. succinogenes:

  • Compare biofilm formation between wild-type and MscL mutant strains

  • Quantify biofilm formation using crystal violet assays and confocal microscopy

  • Analyze biofilm architecture and matrix composition

  • Investigate gene expression changes in biofilm versus planktonic cells

Industrial relevance:

  • A. succinogenes naturally forms biofilms, which can be advantageous in certain bioreactor configurations

  • Enhanced biofilm formation could improve cell retention in continuous fermentation systems

  • Biofilm-based processes may offer advantages for high-density fermentations

Understanding and potentially engineering MscL function could provide new strategies for optimizing biofilm-based succinic acid production systems, potentially improving productivity and stability in industrial applications.

How does MscL function relate to metabolic engineering strategies for enhanced succinic acid production?

The connection between MscL function and metabolic engineering for succinic acid production represents an innovative research direction with several potential aspects:

Physiological connections:

  • Succinic acid production creates significant osmotic and pH stress

  • MscL function may help maintain cellular homeostasis during high-flux metabolism

  • Membrane tension and cellular energetics are linked through proton motive force

Potential engineering strategies:

  • Modulate MscL expression levels to improve stress tolerance during high-titer production

  • Engineer MscL variants with altered gating properties

  • Combine MscL modifications with traditional metabolic pathway engineering

  • Integrate MscL engineering with biofilm optimization strategies

Experimental approaches:

  • Compare fermentation performance of wild-type versus MscL-modified strains

  • Analyze the metabolic flux distribution in MscL variants

  • Investigate potential connections between membrane homeostasis and central carbon metabolism

  • Monitor cell viability and stress responses during high-titer production

Potential benefits:

  • Improved cell viability during high-titer fermentation

  • Enhanced tolerance to by-product accumulation

  • Better maintenance of metabolic activity during extended fermentations

  • Potential synergies with other metabolic engineering strategies

This integrated approach of combining mechanosensitive channel engineering with traditional metabolic engineering represents a novel strategy that addresses both metabolic and physiological aspects of succinic acid production.

What structural and functional differences exist between MscL from A. succinogenes and other bacterial species?

Understanding the structural and functional differences between A. succinogenes MscL and those from other bacteria requires comparative analysis:

Sequence and structural analysis approaches:

  • Multiple sequence alignment with well-characterized MscL proteins (E. coli, M. tuberculosis)

  • Homology modeling based on existing crystal structures

  • Analysis of conservation patterns in key functional domains

  • Molecular dynamics simulations to predict functional properties

Key structural features to analyze:

  • Transmembrane domains: Number, arrangement, and hydrophobicity profiles

  • Pore-lining residues: Amino acid composition affecting conductance and selectivity

  • Tension-sensing regions: Residues that determine gating threshold

  • N-terminal and C-terminal domains: Regions that may confer species-specific functions

Functional implications to investigate:

  • Differences in gating tension threshold related to A. succinogenes' natural environment

  • Channel conductance and ion selectivity properties

  • Potential adaptations related to acid tolerance

  • Species-specific protein-protein interactions

Experimental validation approaches:

  • Heterologous expression and electrophysiological characterization

  • Creation of chimeric channels combining domains from different species

  • Site-directed mutagenesis to test the importance of specific residues

  • Complementation studies in MscL-deficient strains

This comparative analysis could reveal adaptations specific to A. succinogenes' lifestyle and provide insights for engineering MscL variants with desired properties for biotechnological applications.

How can MscL expression be optimized in recombinant A. succinogenes strains?

Optimizing MscL expression in A. succinogenes requires careful consideration of several factors:

Promoter selection strategies:

  • Constitutive expression: The BBa_J23100 promoter has been characterized as the strongest constitutive promoter in A. succinogenes

  • Inducible systems: A modified lac promoter system has demonstrated a 481-fold dynamic range of expression

  • Consider that extremely high expression of membrane proteins can sometimes be toxic

Expression vector considerations:

  • Plasmid copy number affects expression levels

  • Chromosomal integration provides stable expression but typically at lower levels

  • Selection marker compatibility with production conditions

Codon optimization approaches:

  • Analyze codon usage bias in A. succinogenes

  • Optimize rare codons while maintaining mRNA secondary structure

  • Consider the impact of codon optimization on translation rate, which can affect membrane protein folding

Expression monitoring methods:

  • C-terminal fusion tags (His, FLAG) for detection without interfering with membrane insertion

  • Fluorescent protein fusions to monitor expression and localization

  • Quantitative Western blotting for protein level determination

  • Membrane fractionation to confirm proper localization

Optimized expression conditions:

  • Lower induction temperatures (25-30°C) often improve membrane protein folding

  • Growth phase-dependent induction strategies

  • Media composition adjustments to support membrane protein biogenesis

Balancing expression level with proper folding and membrane insertion is particularly important for membrane proteins like MscL, as improperly folded protein can cause toxicity and inclusion body formation.

What experimental approaches can quantify MscL channel activity in A. succinogenes?

Several complementary approaches can be used to quantify MscL channel activity in A. succinogenes:

Electrophysiological methods:

  • Patch-clamp analysis of giant spheroplasts or reconstituted proteoliposomes

  • Planar lipid bilayer recordings of purified and reconstituted MscL

  • These methods provide direct measurement of channel conductance and gating properties

Fluorescence-based assays:

  • Calcein release assays from liposomes containing reconstituted MscL

  • Voltage-sensitive dyes to monitor membrane potential changes during channel activation

  • Fluorescent solute efflux assays in whole cells

Osmotic survival assays:

  • Compare survival rates of wild-type and MscL-modified strains after hypoosmotic shock

  • Quantify cell lysis using optical density measurements or viability staining

  • Measure solute release during osmotic downshock

Structural and biophysical approaches:

  • Site-directed spin labeling combined with electron paramagnetic resonance (EPR)

  • Fluorescence resonance energy transfer (FRET) to monitor conformational changes

  • Mass spectrometry-based approaches to detect structural changes during gating

Computational methods:

  • Molecular dynamics simulations to predict channel behavior

  • Structure-based predictions of gating properties

  • Modeling of channel-membrane interactions

These complementary approaches provide a comprehensive understanding of MscL function, from molecular mechanisms to physiological roles, enabling rational engineering of channel properties for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.