Recombinant Actinobacillus succinogenes Na (+)-translocating NADH-quinone reductase subunit E

What is the Na(+)-translocating NADH-quinone reductase complex in Actinobacillus succinogenes?

The Na(+)-translocating NADH-quinone reductase (Na+-NQR) in Actinobacillus succinogenes is a membrane protein complex that functions as part of the respiratory chain, coupling NADH oxidation to sodium ion translocation across the cytoplasmic membrane. This respiratory complex consists of six distinct subunits (NqrA, NqrB, NqrC, NqrD, NqrE, and NqrF) that work together to generate a sodium gradient, which is essential for energy conservation in the bacterial cell . The Na+-NQR complex contains a unique set of cofactors including one flavin adenine dinucleotide (FAD), two covalently bound flavin mononucleotides (FMNs), one riboflavin, and two iron-sulfur centers, which facilitate electron transfer from NADH to ubiquinone . Unlike the mitochondrial Complex I that pumps protons, the bacterial Na+-NQR specifically translocates sodium ions, making it a distinct mechanism for respiratory energy conservation found only in bacteria, particularly in pathogens like A. succinogenes and Vibrio cholerae . The gene encoding the NqrE subunit in A. succinogenes is designated as nqrE with the ordered locus name Asuc_0603 .

What is the structural composition of the Na+-NQR subunit E from A. succinogenes?

The Na+-NQR subunit E from Actinobacillus succinogenes (UniProt ID: A6VLY0) consists of 198 amino acids with a specific sequence that contributes to its function within the larger Na+-NQR complex . Structurally, the protein contains highly hydrophobic regions consistent with its role as a membrane-embedded subunit, including several transmembrane domains that anchor it within the cytoplasmic membrane . The full amino acid sequence of NqrE reveals multiple hydrophobic stretches alternating with charged residues, particularly in regions likely involved in ion translocation . Specifically, the sequence (MEHYISLFVKSVFIENMALSFFLGMCTFLAVSKKVSTSFGLGIAVIVVLGIAVPVNQLVYTHILKENALVDGVDLSFLNFITFIGVIAALVQILEMFLDKFVPSLYSALGIFLPLITVNCAIFGGVSFMVQREYNFTESVVYGIGAGTGWMLAIVALAGLTEKMKYADV PAGLRGLGITFITVGLMALGFMSFSGIQL) shows characteristics typical of membrane proteins with transmembrane helices . Biochemical studies suggest that subunit E contributes to forming the sodium translocation pathway within the Na+-NQR complex, though its exact position and interaction with other subunits are still being investigated through advanced structural biology techniques .

How does the Na+-NQR system contribute to A. succinogenes metabolism?

The Na+-NQR system in Actinobacillus succinogenes plays a crucial role in respiratory metabolism by generating a sodium gradient across the cytoplasmic membrane, which drives various cellular processes including ATP synthesis and solute transport. This respiratory component is particularly significant in A. succinogenes, which is known for its ability to produce high levels of succinate from various carbon sources under anaerobic or microaerobic conditions . In A. succinogenes, different respiratory pathways yield different metabolic end products; for instance, under nitrate respiration and fully aerobic respiration, acetate is the primary acid produced from glycerol, whereas under dimethyl sulfoxide respiration and microaerobic conditions, succinate becomes the dominant product . The highest succinate yield observed was 0.69 mol succinate/mol glycerol (69% of the maximum theoretical yield) under microaerobic conditions, suggesting that the respiratory chain components, including Na+-NQR, significantly influence the carbon flux toward succinate production . The Na+ gradient established by Na+-NQR may indirectly affect redox balancing and enzyme activities within central carbon metabolism, contributing to the organism's ability to adapt to different respiratory conditions and potentially affecting the yield of commercially valuable metabolites like succinate .

What methods are used to express and purify recombinant A. succinogenes Na+-NQR subunit E for research purposes?

The expression and purification of recombinant Actinobacillus succinogenes Na+-NQR subunit E typically involve a multi-step process beginning with gene cloning and expression vector construction. Researchers commonly clone the nqrE gene (Asuc_0603) into expression vectors containing appropriate promoters and affinity tags to facilitate subsequent purification . The recombinant protein is available commercially in purified form, stored in Tris-based buffer with 50% glycerol, optimized for maintaining protein stability . For laboratory expression, E. coli is often the preferred heterologous host due to its rapid growth and well-established genetic tools, though expression can be challenging due to the hydrophobic nature of membrane proteins like NqrE . Purification typically involves cell disruption followed by membrane fraction isolation, detergent solubilization, and affinity chromatography utilizing the engineered tag (commonly His-tag, though tag type may vary depending on experimental requirements) . Size exclusion chromatography is frequently employed as a final purification step to ensure high protein homogeneity. For functional studies, researchers must consider the need for proper folding and incorporation of any necessary cofactors, which may require specialized expression conditions or reconstitution protocols .

How can researchers assess the functional activity of recombinant Na+-NQR subunit E?

Assessing the functional activity of recombinant Na+-NQR subunit E requires specialized techniques that account for its role within the larger Na+-NQR complex. Researchers typically employ a combination of in vitro biochemical assays and structural analyses to characterize the protein's function. Electron transfer activities can be measured spectrophotometrically by monitoring the oxidation of NADH and reduction of artificial electron acceptors or natural quinones . Sodium ion translocation activity, which is the primary function of the intact Na+-NQR complex, can be assessed using techniques such as inverted membrane vesicles loaded with sodium-sensitive fluorescent dyes or by measuring 22Na+ uptake in reconstituted proteoliposomes . Proper incorporation of the recombinant subunit E into the complete complex may be necessary for meaningful functional assessment, requiring co-expression with other NQR subunits or reconstitution experiments . Additionally, researchers can use site-directed mutagenesis to modify key residues in NqrE and observe the effects on electron transfer and sodium pumping activities to better understand structure-function relationships . Structural methods such as cryo-electron microscopy have proven valuable in studying conformational changes associated with the catalytic cycle, though these are typically applied to the complete Na+-NQR complex rather than isolated subunits .

What genetic tools are available for manipulating the nqrE gene in A. succinogenes?

Genetic manipulation of the nqrE gene in Actinobacillus succinogenes can be accomplished using several recently developed tools that have expanded the molecular biology capabilities for this organism. A markerless knockout method using natural transformation or electroporation has been established for A. succinogenes, allowing researchers to create targeted gene deletions . This system involves the use of a positive selection marker such as the E. coli icd gene, which complements the inability of certain A. succinogenes strains to utilize isocitrate as a carbon source . The approach employs flanking regions of approximately 1 kb on each side of the target gene (such as nqrE) to facilitate homologous recombination, with knockout frequencies typically between 42% and 100% when using these optimized flanking regions . For subsequent marker removal, the yeast Flp/FRT recombination system has been demonstrated to effectively excise the selection marker, allowing for consecutive genetic modifications . Linear DNA can be introduced into A. succinogenes through both natural transformation and electroporation methods, with electroporation using 300 ng or more of linearized DNA consistently yielding transformants . Researchers have also determined that the presence of uptake signal sequences (USS) in the DNA constructs facilitates natural transformation in A. succinogenes, with a single USS being sufficient to enable DNA uptake and recombination .

What is the relationship between Na+-NQR activity and succinate production in A. succinogenes?

The relationship between Na+-NQR activity and succinate production in Actinobacillus succinogenes represents an intricate connection between respiratory chain function and central carbon metabolism. A. succinogenes is notable for its ability to produce high levels of succinate from various carbon sources, including glycerol, a waste product of biodiesel manufacture . Research has demonstrated that the respiratory conditions significantly influence the distribution of metabolic end products in A. succinogenes, with succinate being the primary product under dimethyl sulfoxide respiration and microaerobic conditions . Under these conditions, A. succinogenes can achieve succinate yields up to 0.69 mol succinate/mol glycerol, representing 69% of the maximum theoretical yield . The Na+-NQR complex, as a primary component of the respiratory chain, likely influences this metabolic flux by affecting the cellular redox balance and energy state . The sodium gradient generated by Na+-NQR may indirectly impact the activities of key enzymes in the succinate-producing pathway, potentially through effects on membrane potential or by influencing the activity of other sodium-dependent transporters and enzymes . Metabolic engineering approaches targeting respiratory components, including potentially the Na+-NQR complex, could therefore provide strategies for enhancing succinate production in A. succinogenes . Recent genetic tools developed for A. succinogenes, including markerless knockout methods, open opportunities for investigating the specific contributions of Na+-NQR components to succinate production through targeted manipulation of genes like nqrE .

How do the structural and functional properties of A. succinogenes Na+-NQR compare with those from other bacterial species?

The Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) complexes from different bacterial species share fundamental principles of function while exhibiting species-specific adaptations. The Na+-NQR from Vibrio cholerae, which has been characterized in greater structural detail than that from Actinobacillus succinogenes, consists of six subunits (NqrA-F) containing a unique set of cofactors including one FAD, two covalently bound FMNs, one riboflavin, and two iron-sulfur centers . These components work together to couple NADH oxidation to sodium ion translocation, generating an electrochemical gradient across the membrane . While comprehensive comparative structural data between A. succinogenes and other bacterial Na+-NQR complexes is limited, the amino acid sequence of A. succinogenes NqrE subunit (198 amino acids) suggests a membrane-embedded protein with multiple transmembrane domains typical of NqrE subunits . The Na+-NQR complex is particularly prevalent among pathogenic bacteria, including multidrug-resistant Pseudomonas and Klebsiella strains in addition to V. cholerae and A. succinogenes, suggesting its importance in bacterial physiology and potential as an antibiotic target . One notable difference across species may lie in the integration of Na+-NQR with other metabolic pathways; in A. succinogenes, the complex appears to influence carbon flux toward succinate under specific respiratory conditions, while other species may show different metabolic connections . Comparative genomics and structural biology approaches continue to reveal both conserved features essential to sodium-pumping function and species-specific adaptations that may reflect different ecological niches or metabolic strategies .

How might recent advances in structural biology techniques further our understanding of Na+-NQR function?

Recent advances in structural biology techniques offer unprecedented opportunities to deepen our understanding of Na+-NQR function in Actinobacillus succinogenes and other bacteria. Cryo-electron microscopy (cryo-EM) has revolutionized the study of membrane protein complexes, allowing researchers to determine structures at near-atomic resolution without the need for crystallization, which has historically been challenging for membrane proteins . This technique has already enabled the visualization of conformational changes in the Na+-NQR complex from Vibrio cholerae that couple electron transfer to ion translocation, providing critical insights into the mechanism of sodium pumping . These studies revealed that ion pumping is driven by large conformational changes, with the redox state of an intramembranous [2Fe-2S] cluster orchestrating movements of subunit NqrC that acts as an electron transfer switch . Similar structural studies focused specifically on the A. succinogenes Na+-NQR complex could reveal species-specific adaptations that might explain its particular metabolic capabilities, especially in relation to succinate production . Integrating structural information with functional studies, such as site-directed mutagenesis of key residues in NqrE and other subunits, could establish precise structure-function relationships . Additionally, emerging techniques like time-resolved cryo-EM and single-particle analysis could potentially capture intermediate states in the catalytic cycle, providing a dynamic picture of how electron transfer events trigger conformational changes that drive sodium translocation .

What are the potential implications of Na+-NQR research for developing new antimicrobial strategies?

Research on Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) has significant implications for developing novel antimicrobial strategies, particularly against pathogens resistant to conventional antibiotics. The Na+-NQR complex occurs exclusively in bacteria and is widespread among pathogens, including Vibrio cholerae and multidrug-resistant Pseudomonas and Klebsiella strains, making it a promising target for new antibiotics . The absence of this complex in human cells reduces the likelihood of host toxicity, potentially allowing for selective targeting of bacterial energy metabolism . Understanding the structure and mechanism of Na+-NQR from various bacterial species, including Actinobacillus succinogenes, contributes to the identification of conserved features that could serve as targets for broad-spectrum antimicrobials . The recent determination of structural snapshots representing different states in the catalytic cycle provides crucial information for structure-based drug design approaches . Inhibitors targeting the unique cofactors found in Na+-NQR or interfering with the conformational changes necessary for sodium pumping could disrupt bacterial bioenergetics without affecting mammalian systems . Additionally, the genetic tools developed for manipulating A. succinogenes, such as markerless knockout methods and the yeast Flp/FRT recombination system, offer valuable approaches for validating Na+-NQR as an antimicrobial target through creation of knockout strains and assessment of their viability under various conditions . As antimicrobial resistance continues to pose a global health challenge, exploration of novel targets like Na+-NQR represents an important avenue for developing the next generation of antibiotics with unique mechanisms of action .

What are the key challenges in expressing and studying membrane proteins like Na+-NQR subunit E?

Expressing and studying membrane proteins like the Na+-NQR subunit E presents numerous technical challenges that require specialized approaches. The hydrophobic nature of membrane proteins, including NqrE with its multiple transmembrane domains, often leads to protein aggregation, misfolding, and toxicity to the expression host when overexpressed . Researchers typically address these issues by using specialized expression vectors with tightly controlled promoters, fusion tags that enhance solubility, and expression hosts adapted for membrane protein production . The choice of detergent for solubilization is critical, as it must effectively extract the protein from the membrane while maintaining native structure and function; screening multiple detergents is often necessary to identify optimal conditions . Reconstitution into lipid environments that mimic the native membrane is essential for functional studies, requiring careful selection of lipid composition and reconstitution methods such as liposome formation or nanodiscs . Structural characterization presents additional challenges, as membrane proteins are notoriously difficult to crystallize for X-ray diffraction studies; recent advances in cryo-electron microscopy have partially overcome this limitation by enabling structure determination without crystallization . For the specific case of NqrE from A. succinogenes, commercially available recombinant protein is stored in Tris-based buffer with 50% glycerol to maintain stability, indicating the need for specialized storage conditions . Additionally, studying the function of individual subunits like NqrE is complicated by their operational context within the larger complex, often necessitating co-expression or reconstitution with partner subunits to observe physiologically relevant activities .

How can researchers overcome the challenges of genetic manipulation in A. succinogenes?

Researchers have developed several strategies to overcome the challenges of genetic manipulation in Actinobacillus succinogenes, enabling more sophisticated metabolic engineering approaches. One significant advance is the development of a markerless knockout method that uses either natural transformation or electroporation to introduce DNA for homologous recombination . This method employs the Escherichia coli icd gene as a positive selection marker, which complements the inability of certain A. succinogenes strains to utilize isocitrate . The approach has been optimized to achieve knockout frequencies between 42% and 100% by using approximately 1 kb of flanking DNA on each side of the selection marker to protect against exonucleases prior to recombination . For marker removal after successful gene knockout, the yeast Flp/FRT recombination system has been demonstrated to effectively excise the selection marker, allowing for consecutive genetic modifications within the same strain . Researchers have determined that incorporating at least one uptake signal sequence (USS) in the knockout construct facilitates natural transformation, while electroporation with 300 ng or more of linearized DNA consistently yields transformants . The optimized protocol has been successfully applied to create various knockout mutants, including Δfrd::icd, ΔpflB::icd, ΔlacZ::icd, Δcit::icd, and Δacn::icd constructs, demonstrating its versatility for targeting different genes . For cases where multiple genes need to be consecutively deleted from one strain, mutant FRT sequences can be used to prevent the Flp recombinase from deleting large sections of the genome .

What strategies can improve the stability and activity of isolated Na+-NQR components for in vitro studies?

Improving the stability and activity of isolated Na+-NQR components, such as subunit E from Actinobacillus succinogenes, requires multifaceted approaches that address the inherent challenges of working with membrane proteins. Optimized buffer systems are crucial, with commercially available recombinant A. succinogenes NqrE being stored in Tris-based buffer supplemented with 50% glycerol to enhance stability . Selection of appropriate detergents is critical, as these molecules must effectively solubilize the protein while preserving its native conformation and functional properties; mild detergents like n-dodecyl-β-D-maltoside (DDM) are often preferred for maintaining protein-protein interactions within complexes like Na+-NQR . Lipid supplementation during purification and storage can help maintain the native-like environment that membrane proteins require for stability, with specific lipid compositions potentially mimicking the A. succinogenes membrane environment . For functional studies, reconstitution into proteoliposomes or nanodiscs provides a membrane-like environment that supports native activity, potentially allowing for measurement of sodium pumping activity through ion flux assays . Stabilizing mutations identified through directed evolution or rational design approaches based on structural information can enhance protein stability without compromising function . The addition of specific cofactors required for Na+-NQR function, such as FAD, FMN, or riboflavin, during purification or reconstitution is essential for maintaining electron transfer capabilities . For subunit E specifically, co-purification with interacting partners from the Na+-NQR complex may provide stabilizing contacts that prevent aggregation and preserve functional conformations, potentially yielding more physiologically relevant insights into its role within the larger complex .