Recombinant Actinobacillus succinogenes Probable intracellular septation protein A (Asuc_0882)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Asuc_0882 is annotated as a "probable intracellular septation protein" in A. succinogenes, suggesting a role in bacterial cell division. Key identifiers include:

ParameterDetails
Gene NameAsuc_0882
SynonymsyciB; Inner membrane-spanning protein YciB
UniProt IDA6VMQ5
Source OrganismActinobacillus succinogenes
Expression SystemE. coli
TagN-terminal His-tag
Protein LengthFull-length (1–178 amino acids)
Molecular WeightNot explicitly stated (estimated via sequence)
Purity>90% (SDS-PAGE verified)
Storage Conditions-20°C/-80°C (lyophilized powder); 4°C for short-term aliquots

Expression and Purification

  • Host: E. coli (inducible expression system).

  • Form: Lyophilized powder in Tris/PBS buffer with 6% trehalose, pH 8.0.

  • Reconstitution: Recommended in deionized sterile water (0.1–1.0 mg/mL), with optional glycerol (5–50%) for long-term storage.

Pathway and Interaction Data

  • Pathways: No explicit pathways are cited in available databases, but homologs in other bacteria (e.g., E. coli YciB) are linked to stress responses or membrane trafficking.

  • Interacting Proteins: No direct interaction partners are documented, though homology-based analysis may suggest associations with division machinery (e.g., FtsZ, ZipA) .

Research Applications

Asuc_0882 is primarily used in:

ApplicationDetails
Structural StudiesX-ray crystallography or cryo-EM to elucidate membrane interaction sites.
Functional AssaysKnockout or complementation studies in A. succinogenes to probe septation.
Protein-Protein InteractionsPull-down assays to identify binding partners.

Critical Data Gaps and Future Directions

  1. Functional Validation: No experimental evidence confirms its role in septation.

  2. Membrane Localization: Confirmed topology (e.g., transmembrane helices) requires biochemical validation.

  3. Comparative Genomics: Homology to E. coli YciB (a stress-response protein) warrants further study.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yciB; Asuc_0882; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Actinobacillus succinogenes (strain ATCC 55618 / 130Z)
Target Names
Asuc_0882
Target Protein Sequence
MKQLLEFIPLILFFTVYKLSGIRDAAITLVIATIVQMLILRVKYGKIEKQQVIMGVAVVF FGLLTAYFNEVKYLQWKVTIVYALFAAILLIGQFVFKTPLIRKLLGKEIELPDTAWQKLN LGWAGFFVLCMLVNIYISQYYSEDIWVDFKSFGIIGMTLLATLITGVYIYRYLPKDKD
Uniprot No.

Target Background

Function

This protein plays a critical role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.

Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Asuc_0882 and what organism does it come from?

Asuc_0882 is a probable intracellular septation protein A derived from Actinobacillus succinogenes, a facultatively anaerobic, pleomorphic, Gram-negative rod bacterium initially isolated from bovine rumen . The bacterium exhibits a distinctive 'Morse code' morphology characteristic of the Actinobacillus genus within the Pasteurellaceae family . A. succinogenes is particularly notable for its remarkable capacity to produce succinic acid at high concentrations (>70 g/L) and can utilize a diverse range of sugars as carbon sources . The strain 130ZT (ATCC 55618) is the type strain of this species and has been extensively characterized for its genetic and metabolic properties . The Asuc_0882 protein is thought to play a role in cellular septation processes based on sequence homology with similar proteins in related bacterial species .

What is the predicted function of Asuc_0882 based on sequence homology?

Based on sequence homology to characterized proteins in related bacteria, Asuc_0882 is predicted to function as an intracellular septation protein involved in bacterial cell division . This prediction is strongly supported by studies of the homologous ispA gene in Shigella flexneri, which was identified through Tn10 mutagenesis as essential for proper cell division . In S. flexneri, mutation of ispA resulted in the formation of long filamentous bacteria lacking septa, with cells becoming trapped within host cells during infection . The ispA protein was found to be crucial for proper cell division and virulence, affecting multiple aspects of the infection process including the ability to polymerize actin, which is necessary for intra- and inter-cellular spreading . Given these similarities, Asuc_0882 likely plays a comparable role in septation and cell division processes in A. succinogenes, potentially contributing to its metabolic capabilities and environmental adaptation strategies .

What are the optimal expression systems for producing recombinant Asuc_0882?

Based on the available data, recombinant Asuc_0882 has been successfully expressed in E. coli expression systems . When designing an expression strategy for this protein, researchers should consider the following methodological approach:

  • Vector selection: For a small, hydrophobic membrane protein like Asuc_0882, vectors containing tightly regulated promoters (such as T7 or tac) are recommended to prevent toxicity issues during expression .

  • Host strain optimization: E. coli BL21(DE3) or its derivatives are preferable host strains, particularly those optimized for membrane protein expression such as C41(DE3) or C43(DE3) .

  • Induction parameters: A lower induction temperature (16-20°C) with reduced IPTG concentration (0.1-0.5 mM) is typically recommended for membrane proteins to allow proper folding and reduce inclusion body formation.

  • Expression verification: Western blotting using anti-His antibodies is an effective method to verify expression, given that the recombinant protein contains a histidine tag .

The choice of expression conditions should be empirically optimized for each specific research application, considering that the hydrophobic nature of Asuc_0882 may present challenges for obtaining correctly folded, functional protein .

What cellular assays are recommended for studying the septation function of Asuc_0882?

To investigate the septation function of Asuc_0882, researchers should implement a multi-faceted approach based on established techniques used to characterize similar proteins like ispA in Shigella flexneri :

  • Complementation studies: Introduce Asuc_0882 into ispA-deficient Shigella strains or other bacteria with septal defects to assess functional complementation .

  • Microscopy-based assays:

    • Phase contrast and fluorescence microscopy to examine cell morphology and septum formation

    • Transmission electron microscopy for detailed visualization of septal structures

    • Fluorescent tagging of Asuc_0882 (C-terminal tags preferable to avoid interfering with signal sequences) to track localization during cell division

  • Cell division dynamics:

    • Time-lapse microscopy to monitor division rates and septal formation

    • Growth curve analysis under various conditions to assess impact on cellular proliferation

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with known septation machinery components

    • Bacterial two-hybrid assays to identify interaction partners

  • Cell spreading assays: For bacteria studied in host cell contexts, intercellular spreading capabilities can be assessed using cell culture models similar to those employed for Shigella, which revealed the importance of ispA in maintaining proper bacterial cell morphology during infection .

These methodological approaches should be adapted based on specific research objectives and the biological context of investigation.

How can researchers purify Asuc_0882 while maintaining its native conformation?

Purification of Asuc_0882 while preserving its native conformation requires specialized approaches for membrane proteins. Based on the available data and general principles for purifying hydrophobic proteins, the following methodological workflow is recommended:

  • Membrane fraction isolation:

    • Harvest cells and lyse using mechanical disruption (French press or sonication)

    • Separate membrane fraction by ultracentrifugation (100,000 × g for 1 hour)

    • Wash membrane pellet with high-salt buffer to remove peripheral proteins

  • Solubilization optimization:

    • Screen detergents (DDM, LDAO, or LMNG) at various concentrations

    • Incubate membranes with selected detergent for 1-2 hours at 4°C with gentle rotation

    • Remove insoluble material by ultracentrifugation

  • Affinity purification:

    • Apply solubilized material to Ni-NTA resin (utilizing the His-tag)

    • Wash with increasing imidazole concentrations (10-40 mM) to remove non-specific binding

    • Elute with higher imidazole concentration (250-300 mM)

  • Quality assessment:

    • SDS-PAGE with Coomassie staining to verify purity

    • Western blot with anti-His antibodies to confirm identity

    • Size-exclusion chromatography to assess oligomeric state and homogeneity

  • Storage considerations:

    • Store in a Tris-based buffer with 50% glycerol at -20°C for extended storage

    • Avoid repeated freeze-thaw cycles as this may compromise protein stability

    • For working aliquots, store at 4°C for up to one week

This methodological approach should be empirically optimized for specific research applications, recognizing that maintaining the native conformation of membrane proteins presents significant technical challenges.

How might Asuc_0882 contribute to the succinic acid production capacity of A. succinogenes?

The potential relationship between Asuc_0882 and the remarkable succinic acid production capacity of A. succinogenes represents an intriguing research question that can be approached from several perspectives:

  • Cellular architecture and metabolism connection:

    • Proper cell division, facilitated by Asuc_0882, may optimize cellular surface area to volume ratios, potentially enhancing nutrient uptake and metabolite export capabilities.

    • The septation process controlled by Asuc_0882 might influence the distribution of metabolic enzymes within the cell, potentially creating microcompartments that favor succinic acid production pathways.

  • Stress response and adaptation:

    • A. succinogenes can produce up to 95 g/L of succinic acid from various substrates including glucose, cane molasses, duckweed powder, cassava powder, and crude glycerol . This high acid production creates significant stress on cellular systems.

    • Proper septation through Asuc_0882 function may contribute to stress tolerance mechanisms that allow continued growth and metabolism under high acid concentrations.

  • Experimental approaches to test this hypothesis:

    • Generate conditional knockdowns or controlled expression systems for Asuc_0882 to examine the impact on succinic acid production.

    • Perform comparative proteomics and metabolomics under various Asuc_0882 expression levels.

    • Analyze the co-expression patterns between Asuc_0882 and known succinic acid pathway genes across different growth conditions.

  • Comparative analysis with other succinic acid producers:

    • Compare septation protein homologs across efficient succinic acid producers including Anaerobiospirillum succiniciproducens, Basfia succiniciproducens, and Mannheimia succiniciproducens .

    • Identify potential correlations between septation protein sequences and succinic acid production capacity.

This research direction could provide valuable insights into the interconnection between bacterial cell division processes and metabolic capabilities, potentially leading to enhanced strains for industrial applications.

How can contradictory experimental results regarding Asuc_0882 function be resolved?

When faced with contradictory experimental results regarding Asuc_0882 function, researchers should employ a systematic approach to contradiction resolution that draws upon established frameworks in scientific investigation:

  • Categorization of contradictions:

    • Classify contradictions based on their nature (negation contradictions, numerical discrepancies, or lexical contradictions) .

    • Determine if contradictions stem from methodological differences, strain variations, or interpretational frameworks.

  • Cross-validation strategies:

    • Employ multiple complementary techniques to assess protein function (e.g., biochemical assays, genetic approaches, and structural analyses).

    • Utilize both in vitro and in vivo systems to comprehensively evaluate functional properties.

  • Systematic parameter variation:

    • Methodically adjust experimental conditions (pH, temperature, salt concentration) to identify context-dependent functionality.

    • Test protein activity across growth phases and metabolic states to detect temporal regulation patterns.

  • Multi-laboratory collaboration:

    • Establish standardized protocols across different research groups to minimize technical variation.

    • Implement blinded experimental designs to reduce confirmation bias.

  • Data integration approaches:

    • Develop computational models that incorporate seemingly contradictory data to identify potential unifying mechanisms.

    • Apply Bayesian statistical frameworks to weight evidence based on methodological robustness.

  • Contextual analysis:

    • Consider whether contradictions reflect actual biological variability in protein function across different conditions.

    • Evaluate whether Asuc_0882 has multiple distinct functions that may appear contradictory when observed in isolation.

This systematic approach aligns with established contradiction resolution frameworks in scientific literature and provides a methodological foundation for reconciling apparently conflicting experimental results.

What protein-protein interaction networks might involve Asuc_0882?

Understanding the protein-protein interaction networks involving Asuc_0882 requires both predictive approaches and experimental validation. Based on knowledge of similar septation proteins and bacterial cell division machinery, researchers should consider:

  • Predicted interaction partners:

    • Core cell division proteins (FtsZ, FtsA, ZipA) that form the divisome complex

    • Peptidoglycan synthesis machinery components involved in septal wall formation

    • Membrane remodeling proteins that facilitate daughter cell separation

    • Regulatory proteins that control the timing and positioning of cell division

  • Experimental approaches for mapping interactions:

    • Bacterial two-hybrid screening: Using Asuc_0882 as bait against an A. succinogenes genomic library

    • Co-immunoprecipitation coupled with mass spectrometry: To identify proteins that physically associate with tagged Asuc_0882

    • Proximity-dependent biotin labeling (BioID): For identifying transient or weak interactions in the native cellular environment

    • Fluorescence resonance energy transfer (FRET): To visualize interactions in live cells

  • Functional validation of interactions:

    • Genetic co-occurrence analysis across bacterial species

    • Phenotypic analysis of double mutants or knockdowns

    • Structural modeling of protein complexes

  • Data integration and network analysis:

    • Construction of interaction networks incorporating experimental and predicted interactions

    • Identification of hub proteins and network modules

    • Comparative analysis with known septation protein networks in model organisms

This comprehensive approach would provide valuable insights into the functional context of Asuc_0882 within the cellular machinery, potentially revealing new therapeutic targets or biotechnological applications.

How does Asuc_0882 compare with similar proteins in other bacterial species?

Comparative analysis of Asuc_0882 with functional homologs in other bacterial species provides crucial insights into its evolutionary conservation and functional significance:

  • Comparison with ispA in Shigella flexneri:

    • The ispA protein in S. flexneri shares significant sequence similarity with Asuc_0882, suggesting functional conservation .

    • In S. flexneri, ispA has been experimentally characterized as essential for proper cell division and virulence .

    • Mutation of ispA in S. flexneri results in filamentous bacteria lacking septa, with cells becoming trapped within host cells during infection .

    • ispA in S. flexneri affects actin polymerization capabilities, which are necessary for intra- and inter-cellular spreading during infection .

    • Like Asuc_0882, ispA encodes a small (21 kDa), very hydrophobic protein .

  • Comparison table of septation proteins across bacterial species:

Bacterial SpeciesProtein NameSize (kDa)Key FunctionsPhenotype of Mutation
A. succinogenesAsuc_0882~21Probable intracellular septationNot experimentally determined
Shigella flexneriIspA21Cell division, actin polymerizationFilamentous cells, reduced virulence
E. coliHomolog between trp and tonBSimilarNot fully characterizedNot fully characterized
Other PasteurellaceaeVarious homologsVariableCell division processesVariable
  • Structural and functional domain analysis:

    • Hydrophobicity profiles suggest Asuc_0882 contains multiple membrane-spanning domains similar to other septation proteins.

    • Conservation analysis of specific amino acid motifs could identify functional domains critical for septation processes.

    • Comparative analysis of post-translational modifications might reveal regulatory mechanisms.

  • Evolutionary considerations:

    • Phylogenetic distribution of Asuc_0882 homologs across the Pasteurellaceae family and beyond.

    • Analysis of selection pressure on different protein domains to identify functionally critical regions.

    • Correlation between protein sequence divergence and host adaptation or metabolic specialization.

This comparative approach highlights the likely conserved role of Asuc_0882 in cell division processes while suggesting potential species-specific adaptations that might contribute to the unique metabolic capabilities of A. succinogenes.

What can we learn about Asuc_0882 from the complete genome sequence of A. succinogenes?

The complete genome sequence of A. succinogenes provides a rich contextual framework for understanding the potential roles and regulation of Asuc_0882:

This genomic context analysis provides a systems-level understanding of Asuc_0882's potential roles within the broader cellular framework of A. succinogenes.

What are common issues when working with recombinant Asuc_0882 and how can they be addressed?

Researchers working with recombinant Asuc_0882 may encounter several technical challenges due to its hydrophobic nature and membrane association. Here are common issues and methodological solutions:

  • Low expression levels:

    • Problem: Hydrophobic membrane proteins often express poorly in standard systems.

    • Solution: Optimize codon usage for the expression host, reduce induction temperature (16-20°C), use specialized E. coli strains (C41/C43), or consider cell-free expression systems for toxic proteins.

  • Protein aggregation and inclusion body formation:

    • Problem: Improper folding leading to insoluble aggregates.

    • Solution: Express as fusion with solubility-enhancing tags (MBP, SUMO), add chemical chaperones to growth media, or develop refolding protocols from inclusion bodies using gradual detergent dialysis.

  • Poor solubilization efficiency:

    • Problem: Difficulty extracting protein from membranes.

    • Solution: Screen different detergents (DDM, LDAO, LMNG) at various concentrations and temperatures; consider using lipid nanodiscs for native-like membrane environment.

  • Protein instability during storage:

    • Problem: Loss of activity during storage.

    • Solution: Store in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage ; avoid repeated freeze-thaw cycles ; maintain working aliquots at 4°C for up to one week .

  • Inconsistent purification results:

    • Problem: Batch-to-batch variability in purity and yield.

    • Solution: Standardize protocols with precise timing, temperature, and buffer compositions; consider automated purification systems to reduce variability.

  • Loss of function during purification:

    • Problem: Protein loses activity during purification steps.

    • Solution: Minimize exposure to harsh conditions; incorporate functional assays at each purification step to track activity; consider mild detergents or amphipols for stabilization.

  • Protein-specific troubleshooting approach:

    • Methodically vary each parameter (pH, salt concentration, detergent type) individually

    • Document all observations systematically

    • Establish positive controls using well-characterized membrane proteins to validate new protocols

These methodological approaches should be adapted based on specific research objectives and available resources, recognizing that membrane protein work requires significant optimization.

How can researchers verify the functional activity of purified Asuc_0882?

Verifying the functional activity of purified Asuc_0882 presents unique challenges due to its predicted role in septation and limited experimental characterization. Researchers should consider multiple complementary approaches:

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to confirm secondary structure content

    • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to verify oligomeric state

    • Thermal shift assays to assess protein stability and ligand binding

  • Membrane incorporation assays:

    • Reconstitution into liposomes or nanodiscs followed by density gradient centrifugation

    • Tryptophan fluorescence analysis to confirm proper membrane insertion

    • Protease protection assays to verify correct topology

  • Functional complementation approaches:

    • Expression of Asuc_0882 in bacterial strains with mutations in homologous septation proteins

    • Microscopic analysis of cell morphology and division patterns in complemented strains

    • Growth rate and viability measurements under various stress conditions

  • Protein-protein interaction validation:

    • In vitro binding assays with predicted divisome components

    • Surface plasmon resonance (SPR) or microscale thermophoresis (MST) to quantify binding affinities

    • Co-sedimentation assays with reconstituted membrane systems

  • Septation-specific biochemical assays:

    • Based on the known role of ispA in Shigella, develop assays that measure:

      • Actin polymerization effects (if relevant in non-pathogenic context)

      • Membrane curvature sensing or induction

      • Peptidoglycan synthesis modulation at division sites

  • Correlative activity measurements:

    • Establish quantitative relationships between protein activity measurements and cellular phenotypes

    • Develop high-throughput screening assays for functional variants

This multi-faceted approach acknowledges the challenges in directly measuring septation protein activity while providing a framework for functional characterization based on complementary methodologies.

What are promising strategies for elucidating the complete functional profile of Asuc_0882?

Advancing our understanding of Asuc_0882 requires innovative, multidisciplinary approaches that build upon existing knowledge while exploring new methodological frontiers:

  • Advanced genetic manipulation strategies:

    • Development of CRISPR-Cas9 systems optimized for A. succinogenes to enable precise genomic modifications

    • Establishment of conditional expression systems for essential genes like Asuc_0882

    • Creation of fluorescent protein fusions for live-cell imaging of protein dynamics during cell division

  • High-resolution structural studies:

    • Cryo-electron microscopy of Asuc_0882 in membrane environments

    • X-ray crystallography of stable protein domains or complexes

    • NMR spectroscopy for dynamic regions and interaction surfaces

    • Integrative structural biology combining multiple techniques with computational modeling

  • Systems biology approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics) under various Asuc_0882 expression levels

    • Flux balance analysis to identify metabolic changes associated with Asuc_0882 perturbation

    • Network modeling to place Asuc_0882 within the broader cellular systems

  • Advanced microscopy techniques:

    • Super-resolution microscopy to visualize septation dynamics at nanometer scale

    • Single-molecule tracking to monitor protein movement during division

    • Correlative light and electron microscopy to connect protein localization with ultrastructural features

  • Synthetic biology applications:

    • Minimal divisome reconstitution in synthetic cells or vesicles

    • Engineering Asuc_0882 variants with enhanced or modified functions

    • Development of biosensors based on Asuc_0882 conformational changes

  • Computational biology integration:

    • Molecular dynamics simulations of membrane interactions

    • Machine learning approaches to predict functional partners

    • Evolutionary analysis across diverse bacterial species

These forward-looking strategies promise to reveal not only the specific functions of Asuc_0882 but also its broader roles in bacterial physiology, potentially leading to applications in biotechnology and synthetic biology.

How might engineered variants of Asuc_0882 be utilized in biotechnology applications?

The engineering of Asuc_0882 variants presents intriguing possibilities for biotechnological applications, particularly in the context of A. succinogenes' remarkable capacity for succinic acid production:

  • Enhanced metabolic production strains:

    • Engineer Asuc_0882 variants that optimize cell division parameters to increase succinic acid production capacity

    • Develop strains with modified septation timing to create optimized cell morphologies for improved substrate uptake and product secretion

    • Create conditional expression systems that coordinate cell division with metabolic phases for maximum productivity

  • Synthetic biology chassis development:

    • Optimize cell division control for minimal genome versions of A. succinogenes

    • Engineer growth-controlled strains that maintain productivity while limiting biomass accumulation

    • Develop septation mechanisms responsive to specific environmental signals

  • Protein engineering approaches:

    • Rational design of Asuc_0882 variants with enhanced stability for industrial conditions

    • Domain swapping with homologs from extremophiles to increase stress tolerance

    • Directed evolution to select variants with novel properties

  • Methodological workflow for variant creation and testing:

    a. Design phase:

    • In silico prediction of functional domains and critical residues

    • Computational modeling of variant stability and activity

    • Design of combinatorial libraries targeting specific functional properties

    b. Construction phase:

    • Site-directed mutagenesis for rational designs

    • Gene synthesis for major redesigns

    • Assembly of variant libraries

    c. Screening phase:

    • High-throughput phenotypic screening under industrial conditions

    • Selection systems coupling variant function to growth advantage

    • Microscopy-based screening for morphological optimization

    d. Validation phase:

    • Detailed characterization of promising variants

    • Integration of variants into production strains

    • Scale-up testing in bioreactor conditions

  • Potential industrial applications:

    • Optimized strains for bio-based succinic acid production from renewable feedstocks

    • Engineered cellular factories with enhanced stress tolerance

    • Controlled biofilm formation for immobilized cell bioreactors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.