Recombinant Actinobacillus succinogenes UPF0283 membrane protein Asuc_0957 (Asuc_0957)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Actinobacillus succinogenes UPF0283 Membrane Protein Asuc_0957 (Asuc_0957)

Actinobacillus succinogenes UPF0283 membrane protein Asuc_0957 (Asuc_0957) is a protein associated with Actinobacillus succinogenes, a bacterium known for its ability to produce succinic acid . Asuc_0957 is a membrane protein, which means it is located in the cell membrane of the bacterium . The protein is also referred to as UPF0283 membrane protein Asuc_0957, with Asuc_0957 being its ordered locus name .

Key Details:

  • Organism: Actinobacillus succinogenes

  • Protein Type: Membrane protein

  • Locus Name: Asuc_0957

  • Alternative Name: UPF0283 membrane protein Asuc_0957

Characteristics of Asuc_0957

The Asuc_0957 protein is a full-length protein consisting of 360 amino acids . The molecular weight and specific functions of Asuc_0957 are not clearly defined in the current literature, further study may be needed to elucidate its precise biological role.

Properties:

PropertyDescription
Amino Acid SequenceMNDKRVFNHVENNAGNEEEVFRVKREFSETAEIIPDLTALDDEREEKQALEGELLASQFEQAVRPRFRWWKRAVIAVAVLFLGATVAQSVQWLIDTWQANQWIYFAFAVVGCSVVGLGLSALGREFLRLRKLRQHLALRAESAVEFKDDFEIDKAKKLCGEITSSLGMDAQHPTVIQWQKQLNDGLTAREVGELFSKNVLYPIDNKAKKLITQSAVENGIVVAISPLAIVDMLFLAWRNTRLINRIANIYGIELGYWSRLRLMRMVFINMAFTGATELVQDIGLDWLSQDITAKLSGRIGQGLGVGLLTARLGIKTMEFCRPLTFNKDEKPRLSHIHRELLTSLKSVVLRSDKSRKKQNV
Length360 amino acids

Production and Availability

Asuc_0957 is produced as a recombinant protein in E. coli . It is available from commercial sources as a His-tagged protein . The protein is typically supplied as a lyophilized powder and should be stored at -20°C to -80°C . Repeated freezing and thawing should be avoided .

Availability:

  • Expression Host: E. coli

  • Tag: His-tagged

  • Form: Lyophilized powder

  • Purity: Greater than 90% as determined by SDS-PAGE

  • Storage: -20°C/-80°C, avoid repeated freeze-thaw cycles

  • Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Function and Role in Actinobacillus succinogenes

Actinobacillus succinogenes is used for succinic acid production . Succinic acid is a dicarboxylic acid that can be used to create a variety of bioproducts . A. succinogenes is able to convert both pentose and hexose sugars into succinic acid, and it can also incorporate CO2 into succinic acid . Metabolic engineering of A. succinogenes can further improve succinic acid production .

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes. We will fulfill your request to the best of our ability.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request, with an additional fee. Please contact us in advance to arrange this.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.

Tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.

Synonyms
Asuc_0957; UPF0283 membrane protein Asuc_0957
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
full length protein
Species
Actinobacillus succinogenes (strain ATCC 55618 / 130Z)
Target Names
Asuc_0957
Target Protein Sequence
MNDKRVFNHVENNAGNEEEVFRVKREFSETAEIIPDLTALDDEREEKQALEGELLASQFE QAVRPRFRWWKRAVIAVAVLFLGATVAQSVQWLIDTWQANQWIYFAFAVVGCSVVGLGLS ALGREFLRLRKLRQHLALRAESAVEFKDDFEIDKAKKLCGEITSSLGMDAQHPTVIQWQK QLNDGLTAREVGELFSKNVLYPIDNKAKKLITQSAVENGIVVAISPLAIVDMLFLAWRNT RLINRIANIYGIELGYWSRLRLMRMVFINMAFTGATELVQDIGLDWLSQDITAKLSGRIG QGLGVGLLTARLGIKTMEFCRPLTFNKDEKPRLSHIHRELLTSLKSVVLRSDKSRKKQNV
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Actinobacillus succinogenes and why is it significant in bioproduction research?

Actinobacillus succinogenes is a Gram-negative facultative anaerobe that has gained significant attention in the field of industrial biotechnology due to its natural capacity to convert both pentose and hexose sugars to succinic acid (SA) with high yield. This organism is particularly valuable because it is capnophilic, meaning it can incorporate CO₂ into succinic acid during fermentation, enhancing carbon efficiency in the bioprocess . This characteristic makes A. succinogenes an ideal candidate host organism for converting lignocellulosic sugars and CO₂ into succinic acid, which is an emerging commodity bioproduct that can be sourced from renewable feedstocks .

The significance of A. succinogenes lies in its potential to improve the economic feasibility of modern biorefineries through efficient succinic acid production from lignocellulosic residues. This capability addresses both industrial biotechnology needs and environmental sustainability goals by utilizing renewable carbon sources and sequestering CO₂ .

What recombinant expression systems are currently available for Asuc_0957 protein?

Currently, the documented recombinant expression system for Asuc_0957 utilizes Escherichia coli as the host organism . The recombinant protein is expressed as a full-length construct (amino acids 1-360) with an N-terminal His-tag to facilitate purification . This expression system allows for the production of recombinant Asuc_0957 that can be purified to greater than 90% purity as determined by SDS-PAGE analysis .

The expression in E. coli represents a common approach for recombinant protein production, leveraging the well-established molecular tools and rapid growth characteristics of this organism. The addition of the His-tag enables efficient purification using immobilized metal affinity chromatography, which is particularly important for membrane proteins that may be challenging to purify by other methods .

How might the UPF0283 membrane protein Asuc_0957 potentially relate to succinic acid production in A. succinogenes?

While the direct role of UPF0283 membrane protein Asuc_0957 in succinic acid production has not been explicitly established in the provided literature, we can hypothesize potential relationships based on metabolic considerations and membrane protein functions:

  • Transport Function Hypothesis: As a membrane protein, Asuc_0957 may function in transport processes. In the context of succinic acid production, it could potentially be involved in:

    • Substrate uptake (hexose or pentose sugars)

    • Export of succinic acid from the cytoplasm

    • CO₂ transport or facilitation, given the capnophilic nature of A. succinogenes

  • Membrane Integrity Hypothesis: The protein may contribute to maintaining membrane integrity under the acidic conditions that develop during fermentation. Succinic acid production creates increasingly acidic environments that can stress cellular membranes.

  • Metabolic Connection Hypothesis: It could potentially interact with or regulate enzymes involved in the reductive branch of the TCA cycle, which is critical for succinic acid biosynthesis in A. succinogenes .

To investigate these hypotheses, researchers could design knockout experiments similar to those performed for other pathways in A. succinogenes (such as acetate and formate production pathways) . Monitoring changes in succinic acid production, membrane integrity, or specific transport functions in knockout strains would help elucidate the role of Asuc_0957.

What experimental design approaches are most appropriate for studying membrane proteins like Asuc_0957?

Studying membrane proteins requires specialized experimental designs that address their unique challenges:

For Asuc_0957 specifically, an effective experimental design strategy would combine:

  • Initial Characterization: Expression optimization in E. coli with His-tag purification, followed by structural studies .

  • Functional Assessment: Generation of knockout strains in A. succinogenes and assessment of phenotypic changes, particularly in succinic acid production pathways .

  • Localization Studies: Fluorescent tagging or immunolocalization to confirm membrane localization and distribution.

  • Transport Assays: If transport function is suspected, design of appropriate assays using reconstituted protein in artificial membrane systems.

When selecting an experimental design, considerations should include the specific research question, available resources, and the balance between depth of information and technical feasibility .

How can metabolic engineering approaches be applied to study the role of Asuc_0957 in the context of A. succinogenes metabolism?

Metabolic engineering approaches can be systematically applied to study Asuc_0957 in the context of A. succinogenes metabolism, building upon the established engineering capabilities demonstrated for other pathways :

  • Gene Knockout Strategy:

    • Create an Asuc_0957 knockout strain using homologous recombination or CRISPR-Cas9 technology

    • Compare growth characteristics, membrane integrity, and metabolic profiles with wild-type strains

    • Assess changes in succinic acid production and by-product formation

  • Overexpression Strategy:

    • Develop strains with controlled overexpression of Asuc_0957

    • Evaluate effects on cell physiology and succinic acid production

    • This approach parallels the overexpression studies of malate dehydrogenase that enhanced SA flux

  • Reporter Fusion Strategy:

    • Create translational fusions with reporter proteins to study expression patterns

    • Investigate regulation under different growth conditions and carbon sources

  • Metabolic Flux Analysis:

    • Conduct 13C-metabolic flux analysis to track carbon flow in wild-type vs. modified strains

    • Identify changes in flux distribution when Asuc_0957 is altered

  • Combinatorial Engineering:

    • Combine Asuc_0957 modifications with alterations in competing pathways (acetate, formate, lactate)

    • This approach could reveal synergistic or antagonistic effects, similar to how removal of competitive carbon pathways affected succinic acid purity

Implementation of these strategies would require careful experimental design with appropriate controls, considering that membrane protein manipulation can have pleiotropic effects on cellular physiology.

What are the optimal conditions for expression and purification of recombinant Asuc_0957?

Based on the available information, the following protocol represents the optimal conditions for expression and purification of recombinant Asuc_0957:

Expression System:

  • Host organism: Escherichia coli

  • Expression construct: Full-length Asuc_0957 (amino acids 1-360) with N-terminal His-tag

Purification Protocol:

  • Initial purification using immobilized metal affinity chromatography (leveraging the His-tag)

  • Purity assessment by SDS-PAGE (target >90% purity)

  • Buffer formulation: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

Storage Recommendations:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • For working solutions:

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (recommended 50%)

    • Aliquot to avoid repeated freeze-thaw cycles

    • Store at -20°C/-80°C for long-term storage

Critical Considerations:

  • Repeated freeze-thaw cycles should be avoided

  • Working aliquots can be stored at 4°C for up to one week

  • Prior to opening, vials should be briefly centrifuged to bring contents to the bottom

For membrane proteins like Asuc_0957, additional optimization may be beneficial but not explicitly mentioned in the available literature, including:

  • Detergent screening for solubilization

  • Expression temperature optimization (often lower temperatures improve membrane protein folding)

  • Inclusion of specific lipids or stabilizing agents during purification

How can researchers verify the functional integrity of recombinant Asuc_0957 after purification?

Verifying the functional integrity of recombinant membrane proteins like Asuc_0957 presents unique challenges. A comprehensive approach would include:

Structural Integrity Assessment:

  • Circular Dichroism (CD) Spectroscopy: To confirm proper secondary structure formation, particularly important for alpha-helical membrane proteins

  • Size Exclusion Chromatography: To verify monodispersity and proper oligomeric state

  • Thermal Shift Assays: To assess protein stability and proper folding

Functional Verification:
Since the specific function of Asuc_0957 is not definitively established, functional verification would require:

  • Reconstitution Studies: Incorporation into liposomes or nanodiscs to recreate a membrane environment

  • Binding Assays: If potential ligands or interaction partners are identified, binding studies using techniques such as:

    • Surface Plasmon Resonance (SPR)

    • Isothermal Titration Calorimetry (ITC)

    • Fluorescence-based binding assays

  • Activity Assays: Development of specific assays based on hypothesized functions:

    • If transport function is suspected: substrate uptake or efflux assays in reconstituted systems

    • If regulatory function is suspected: protein-protein interaction studies with metabolic enzymes

Structural Studies:
For more detailed structural verification:

  • Limited Proteolysis: To assess proper folding and domain organization

  • Hydrogen-Deuterium Exchange Mass Spectrometry: To probe solvent accessibility and conformational dynamics

  • Advanced Structural Methods: Where resources permit, techniques such as cryo-electron microscopy or X-ray crystallography

The verification approach should be tailored to the research goals and available resources, with the recognition that membrane protein functional studies often require specialized techniques not commonly used for soluble proteins.

What statistical approaches are appropriate for analyzing experiments involving Asuc_0957 and succinic acid production?

When analyzing experiments involving Asuc_0957 and its potential impact on succinic acid production, researchers should select statistical approaches based on experimental design and data characteristics. Appropriate statistical frameworks include:

For Comparative Studies (Wild-type vs. Modified Strains):

  • Student's t-test or ANOVA: For comparing succinic acid yields or concentrations between wild-type and Asuc_0957 modified strains

    • Use paired t-tests when comparing the same strain under different conditions

    • Use ANOVA for multi-factor experiments or when comparing more than two strains

  • Regression Analysis: For establishing relationships between Asuc_0957 expression levels and metabolic outputs

    • Multiple regression can incorporate additional factors such as cultivation conditions

    • Nonlinear regression may be necessary for complex relationships in metabolic systems

For Time-Series Fermentation Data:

  • Repeated Measures ANOVA: For analyzing production profiles over time

  • Growth Curve Fitting: Nonlinear regression to appropriate growth models

  • Time Series Analysis: For identifying patterns in temporal data

For Multi-Omics Integration:
If combining proteomics, metabolomics, and transcriptomics data:

  • Principal Component Analysis (PCA): For dimensionality reduction and identification of major variance components

  • Partial Least Squares Discriminant Analysis (PLS-DA): For identifying variables that contribute to separation between experimental groups

  • Network Analysis: For understanding system-wide changes related to Asuc_0957 modification

  • Expected effect size based on preliminary data

  • Desired statistical power (typically 0.8 or greater)

  • Significance level (typically α = 0.05)

  • Variability in the measured parameters

The selected statistical approach should be justified based on the experimental design and data properties, with appropriate attention to assumptions such as normality and homogeneity of variance .

How should researchers address data contradictions when studying novel membrane proteins like Asuc_0957?

When encountering contradictory data in research on novel membrane proteins like Asuc_0957, researchers should implement a systematic approach to resolution:

  • Validation of Experimental Methods

    • Independently verify protein identity through mass spectrometry or sequencing

    • Assess purity by multiple methods (SDS-PAGE, Western blot, analytical SEC)

    • Evaluate expression system influence by testing alternative hosts or constructs

    • Consider whether His-tag or other modifications might affect function

  • Systematic Variation of Experimental Conditions

    • Create a structured experimental design that systematically varies:

      • Buffer composition (pH, ionic strength, specific ions)

      • Temperature and incubation times

      • Detergent types and concentrations for membrane protein studies

      • Presence of potential cofactors or substrates

  • Cross-Validation with Multiple Techniques

    • Employ orthogonal methods to test the same hypothesis

    • For structure: Compare results from CD spectroscopy, HDX-MS, and computational predictions

    • For function: Compare in vivo phenotypes with in vitro reconstitution experiments

  • Integration of Contradictory Results

    • Develop a model that accounts for seemingly contradictory results

    • Consider context-dependent protein behavior (different functions under different conditions)

    • Evaluate whether contradiction represents true biological complexity rather than experimental error

  • Reporting Approach

    • Transparently report all contradictory results

    • Provide raw data and detailed methodologies to enable replication

    • Discuss possible explanations for contradictions

    • Propose specific experiments to resolve remaining questions

This structured approach acknowledges that contradictions in membrane protein research often reveal important biological complexities rather than simply representing experimental errors. The resolution process itself may lead to novel insights about protein function or behavior in different contexts.

What are the promising research avenues for understanding the relationship between Asuc_0957 and metabolic engineering for succinic acid production?

Several promising research avenues could advance understanding of Asuc_0957 and its potential relevance to metabolic engineering for succinic acid production:

  • Comprehensive Functional Characterization

    • Development of Asuc_0957 knockout and overexpression strains in A. succinogenes

    • Metabolic profiling under different carbon sources and fermentation conditions

    • Integration with existing knowledge about acetate and formate pathway engineering

  • Structural Biology Approaches

    • Determination of Asuc_0957 structure through crystallography or cryo-EM

    • Structure-guided mutagenesis to identify functional domains

    • Computational modeling of protein-membrane interactions

  • Systems Biology Integration

    • Multi-omics analysis (transcriptomics, proteomics, metabolomics) of wild-type and Asuc_0957-modified strains

    • Flux balance analysis incorporating membrane protein functions

    • Development of genome-scale metabolic models that include membrane transport processes

  • Applied Bioprocess Engineering

    • Evaluation of Asuc_0957 modifications in industrial fermentation conditions

    • Testing performance on actual lignocellulosic hydrolysates with complex sugar mixtures

    • Scale-up studies to assess industrial relevance of any beneficial modifications

  • Comparative Genomics Approach

    • Identification and characterization of UPF0283 family proteins in other succinic acid producers

    • Evolutionary analysis to identify conserved features that might indicate functional importance

    • Heterologous expression studies to test functional conservation

This research agenda combines fundamental protein characterization with applied metabolic engineering approaches, potentially revealing new strategies for enhancing succinic acid production from renewable feedstocks. The focus on membrane proteins represents a relatively unexplored area in metabolic engineering of A. succinogenes, which has typically centered on cytoplasmic metabolic enzymes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.