Recombinant Adelaide River virus Protein alpha-1

Shipped with Ice Packs
In Stock

Description

Overview of Adelaide River Virus and Alpha-1 Protein

Adelaide River virus (ARV) is an arthropod-borne rhabdovirus first identified in Australian cattle. Its genome encodes five canonical structural proteins (N, P, M, G, L) and accessory proteins, including alpha-1 . While ARV alpha-1 remains understudied, its homolog in Bovine Ephemeral Fever Virus (BEFV) has been characterized as a viroporin—a small transmembrane protein that modulates cellular membrane permeability and viral pathogenesis .

Functional Insights from Homologous Proteins

Experimental studies on BEFV alpha-1 provide functional inferences for ARV alpha-1:

  • Viroporin Activity: BEFV alpha-1 increases membrane permeability in E. coli and mammalian cells, facilitating viral replication . ARV alpha-1 likely shares this role due to conserved transmembrane domains.

  • Nuclear Trafficking Modulation: BEFV alpha-1 binds importin β1 and importin 7, nuclear transport receptors, suggesting a role in disrupting host immune responses . ARV alpha-1’s C-terminal NLS implies similar interactions .

  • Growth Arrest in Host Cells: Expression of BEFV alpha-1 inhibits bacterial and mammalian cell growth, a trait hypothesized to aid viral spread .

Phylogenetic and Evolutionary Context

ARV clusters closely with BEFV within the Ephemerovirus genus, sharing 48.3% amino acid similarity in their nucleoproteins . Both viruses encode accessory proteins (alpha-1, alpha-2, β, γ) of unknown function, but alpha-1 is the most conserved. Phylogenetic analysis of rhabdovirus N proteins places ARV and BEFV in a clade distinct from vesiculoviruses and lyssaviruses, highlighting unique evolutionary adaptations .

Knowledge Gaps and Future Directions

Direct experimental data on ARV alpha-1 are lacking, with most inferences drawn from BEFV studies. Key unresolved questions include:

  • Structural Resolution: No crystallographic or cryo-EM data exist for ARV alpha-1.

  • Host Interactions: The role of importin binding and nuclear trafficking in ARV pathogenesis remains untested.

  • In Vivo Pathogenicity: How alpha-1 contributes to ARV’s clinical manifestations in cattle is unknown.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Protein alpha-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Adelaide River virus (ARV)
Target Protein Sequence
MADHARLISLPSSVQDFFNQISSIFKSIENFYLLYKTRLKIFLICTIALIVIVLVAKIIK YTLAFHACIKIYCKPLIKTTNCLLKLGKRKRRKKKRKGKSIRLKELSS
Uniprot No.

Target Background

Database Links

KEGG: vg:26123214

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Adelaide River virus and how is the alpha-1 protein positioned within its genome?

Adelaide River virus (ARV) is a member of the family Rhabdoviridae. The virus has a complex genome organization, particularly in the region between the second glycoprotein (GNS) gene and the L gene. A 2341-nucleotide region located immediately downstream of the GNS gene contains four long open reading frames (ORFs). Between the GNS and L genes are two coding regions separated by a single nucleotide (C), each bounded by recognized transcription initiation (AACAG) and termination/polyadenylation (CATG[A]7) sequences. The first coding region comprises 682 nucleotides and contains the alpha-1 and alpha-2 ORFs, which are in the same reading frame but separated by two consecutive stop codons . This genomic arrangement is important for understanding how alpha-1 protein expression is regulated during viral replication.

What are the structural and functional characteristics of ARV alpha-1 protein?

The alpha-1 ORF of Adelaide River virus encodes a 12,545-Da polypeptide with distinctive structural domains. Analysis of its sequence reveals that it contains highly hydrophobic and highly basic domains . These structural characteristics suggest potential roles in membrane interaction and nucleic acid binding, respectively. While the specific functions of ARV alpha-1 have not been fully characterized in the provided search results, proteins with similar structural characteristics in related viruses often participate in viral replication, modulation of host immune responses, or virus assembly. The presence of hydrophobic domains suggests possible association with cellular or viral membranes during the virus life cycle.

How is the alpha-1 protein expressed during ARV infection?

In ARV-infected cells, the alpha region is not expressed as an isolated transcript but rather as part of a long 4.7-kb polycistronic mRNA containing multiple genes. This mRNA includes the G, GNS, alpha-1, and alpha ORFs . Direct sequence analysis of this mRNA has confirmed that the tandem stop codons separating the alpha-1 and alpha-2 ORFs are retained in the transcript . This expression pattern as part of a polycistronic message suggests that alpha-1 protein production is coordinated with other viral proteins during infection, potentially ensuring proper stoichiometric relationships between different viral components.

What approaches are used to clone and express recombinant viral proteins similar to ARV alpha-1?

Recombinant expression of viral proteins typically involves several key steps: gene identification, PCR amplification, cloning into expression vectors, transformation into host cells, protein expression, and purification. For ARV alpha-1, researchers would first need to isolate viral genomic RNA, perform reverse transcription to generate cDNA, and then amplify the alpha-1 gene using specific primers. Similar to approaches used for other recombinant proteins like alpha-1-antitrypsin (A1AT), the gene would be cloned into appropriate expression vectors .

Expression systems might include bacterial systems (E. coli), yeast, insect cells using baculovirus, or mammalian cells. For viral proteins with complex structures or post-translational modifications, mammalian expression systems such as Chinese Hamster Ovary (CHO) cells might be preferred, as demonstrated with recombinant A1AT . The choice of expression system would depend on the structural complexity of the ARV alpha-1 protein and the research objectives.

What methods can be used to analyze the expression and localization of recombinant ARV alpha-1 protein?

Analysis of recombinant ARV alpha-1 expression would typically involve:

  • Western blotting to confirm protein expression and determine molecular weight

  • Immunofluorescence microscopy to examine cellular localization

  • Mass spectrometry for protein identification and characterization

  • Structural analysis using techniques such as circular dichroism (CD) or X-ray crystallography

For cellular localization studies, researchers could use fluorescently tagged versions of the recombinant protein or specific antibodies against the protein. Subcellular fractionation followed by western blotting could also determine whether the protein associates with specific cellular compartments, which would be particularly relevant given the hydrophobic domains that suggest potential membrane association .

What are the optimal expression systems for producing functional recombinant ARV alpha-1 protein?

The optimal expression system for recombinant ARV alpha-1 would depend on several factors including the need for post-translational modifications, protein solubility, and functional requirements. Based on approaches used for other complex viral proteins, several systems merit consideration:

  • Mammalian cell systems: Chinese Hamster Ovary (CHO) cells have proven effective for producing complex glycoproteins like alpha-1-antitrypsin. Glycoengineered CHO cells (geCHO-L) have been used to produce recombinant human A1AT with glycosylation profiles identical to plasma-derived counterparts . For ARV alpha-1, if glycosylation or other mammalian-specific modifications are important, this system would be advantageous.

  • Insect cell/baculovirus systems: These provide higher yields than mammalian systems while still allowing for many post-translational modifications.

  • Yeast systems: Pichia pastoris or Saccharomyces cerevisiae can produce high quantities of recombinant proteins with some post-translational modifications.

The expression strategy should include optimization of codon usage for the host system, careful design of purification tags that won't interfere with protein function, and expression condition optimization (temperature, induction time, media composition).

How can researchers evaluate the impact of ARV alpha-1 protein on host immune responses?

To study the immunomodulatory effects of recombinant ARV alpha-1 protein, researchers could employ several experimental approaches:

  • In vitro immune cell assays: Testing the effect of purified recombinant protein on various immune cell populations (macrophages, dendritic cells, T cells) to measure changes in cytokine production, cell activation markers, and functional responses. This is particularly relevant given that some viral proteins can modulate type I interferon responses, as seen with variants of Ross River virus .

  • Reporter systems: Using cells transfected with reporter constructs (e.g., luciferase under control of immune response promoters like IFN-β or NF-κB) to detect whether ARV alpha-1 enhances or suppresses signaling pathways.

  • Comparative studies: Comparing immune responses in cells exposed to wild-type virus versus recombinant virus lacking the alpha-1 gene, or comparing responses between recombinant alpha-1 protein and known immunomodulatory proteins.

  • Protein-protein interaction studies: Identifying host proteins that interact with ARV alpha-1 using techniques such as co-immunoprecipitation, pull-down assays, or yeast two-hybrid screening to identify potential immune pathway targets.

Analysis should include multiple immune cell types, as viral proteins often have cell-type specific effects on immune function.

What challenges exist in purifying recombinant ARV alpha-1 protein and how can they be addressed?

Purification of recombinant ARV alpha-1 protein may present several challenges:

  • Protein solubility: Given its highly hydrophobic domains , ARV alpha-1 might form aggregates or inclusion bodies. Strategies to address this include:

    • Using detergents or chaotropic agents for initial solubilization

    • Expressing fusion proteins with solubility-enhancing tags (MBP, SUMO, thioredoxin)

    • Optimizing expression conditions (lower temperature, slower induction)

    • Refolding protocols if extraction from inclusion bodies is necessary

  • Purification strategy design: A multi-step purification approach would likely be necessary:

    • Initial capture using affinity chromatography (His-tag, GST-tag)

    • Intermediate purification using ion exchange chromatography (given the basic domains in alpha-1 )

    • Polishing step using size exclusion chromatography

  • Protein verification: Confirming proper folding and function through:

    • Circular dichroism to assess secondary structure

    • Limited proteolysis to evaluate structural integrity

    • Functional assays based on predicted protein activity

The purification strategy should be optimized to maintain the native conformation of the protein, particularly if functional studies are planned.

How can structural biology approaches enhance understanding of ARV alpha-1 protein function?

Structural characterization of ARV alpha-1 would provide valuable insights into its function and mechanisms of action. Several complementary approaches could be employed:

Structural insights would guide the design of functional studies by identifying potential interaction surfaces or catalytic sites within the protein.

What viral vector systems could be utilized to study ARV alpha-1 protein in vivo?

Several viral vector systems could be employed to study ARV alpha-1 protein in experimental animal models:

  • Recombinant adeno-associated virus (rAAV) vectors: These have shown success for gene delivery in various applications due to their advantages: no viral genes in the vector, no requirement for integration for long-term expression, low immunogenicity, and wide tropism . For ARV alpha-1 studies, rAAV vectors could be engineered to express the protein in specific tissues of interest.

  • Lentiviral vectors: Provide stable integration and long-term expression, useful for studying chronic effects of ARV alpha-1 protein.

  • Recombinant rhinovirus vectors: These have been used successfully for mucosal vaccine delivery and could be adapted to study ARV alpha-1 at mucosal surfaces, which might be relevant if the protein has immunomodulatory functions.

  • Modified live ARV with tagged or mutated alpha-1: Creating recombinant viruses with modifications to the alpha-1 gene would allow study of its function in the context of viral infection.

For in vivo studies, considerations would include route of administration (systemic vs. tissue-specific), duration of expression needed, and potential immune responses to the vector itself. Tissue-specific promoters could be used to restrict expression to relevant cell types for more targeted functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.