Recombinant Adiantum capillus-veneris ATP synthase subunit a, chloroplastic (atpI)

What is Adiantum capillus-veneris ATP synthase subunit a (atpI) and what is its function in chloroplasts?

ATP synthase subunit a (atpI) from Adiantum capillus-veneris (Maidenhair fern) is a critical component of the chloroplastic F₀F₁-ATP synthase complex. This protein functions within the F₀ sector embedded in the thylakoid membrane, forming part of the proton channel that facilitates proton movement across the membrane. The proton gradient established during photosynthesis drives ATP synthesis through this complex. AtpI specifically contributes to maintaining the structural integrity of the proton channel and plays a crucial role in the rotational mechanism of ATP synthesis. The protein consists of 248 amino acids and is encoded by the atpI gene in the chloroplast genome. Unlike many other chloroplast proteins such as the PMI1 protein involved in chloroplast movement, atpI is directly involved in energy transduction rather than chloroplast motility .

What is the complete amino acid sequence of recombinant Adiantum capillus-veneris ATP synthase subunit a?

The complete amino acid sequence of the recombinant Adiantum capillus-veneris ATP synthase subunit a (atpI) spans 248 amino acids (region 1-248) and is as follows:

MQIEQLQINEIDNLHQVSSVEVGQHLYWQIGNFQVHAQVLITSWVVVAILVALPATTTGN
LQSIPTGTQNFIEYVLEFIRDLTRTQMGEEGYRPWVPFIGTMFLFIFASNWSGALLPWRV
IQLPHGELAAPTNDINTTVALALLTSVAYFYAGLYKRGFSYFGKYIQPTPILLPINILED
FTKPLSLSFRLFGNILADELVVAVLVSLVPLIVPVPMMLLGLFTSGIQALIFATLAAAYI
GESMEGHH

The recombinant protein is typically produced with an N-terminal 10xHis-tag, which facilitates purification through affinity chromatography. The tag sequence plus any linker regions are not included in the sequence above but can be provided upon request for specific experimental purposes .

What are the optimal storage conditions for recombinant Adiantum capillus-veneris ATP synthase subunit a?

For optimal stability and activity maintenance of recombinant Adiantum capillus-veneris ATP synthase subunit a, the following storage conditions are recommended:

Temperature requirements:

• Store at -20°C/-80°C upon receipt

• Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

Storage duration by formulation:

• Liquid form: Maintains stability for approximately 6 months at -20°C/-80°C

• Lyophilized form: Retains stability for approximately 12 months at -20°C/-80°C

The shelf life is influenced by multiple factors including storage state, buffer composition, storage temperature, and the intrinsic stability of the protein itself. For experiments requiring long-term storage, the lyophilized powder format is preferable due to its extended shelf life .

How does the buffer composition affect protein stability and experimental outcomes?

The buffer composition significantly impacts protein stability and experimental outcomes when working with recombinant Adiantum capillus-veneris ATP synthase subunit a. The protein is typically lyophilized from a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 .

Key considerations for buffer selection:

When designing experiments with atpI, researchers should consider buffer compatibility with downstream applications. For functional assays of ATP synthase activity, buffers containing appropriate levels of magnesium and phosphate may be necessary. For structural studies, buffer conditions should be optimized to prevent protein aggregation while maintaining native conformation.

Similar considerations have been demonstrated with other membrane proteins like the mitochondrial ADP/ATP carrier (Ancp), where specific buffer conditions were critical for successful crystallization and structural determination .

What are the optimal conditions for expression and purification of recombinant Adiantum capillus-veneris ATP synthase subunit a?

The successful expression and purification of recombinant Adiantum capillus-veneris ATP synthase subunit a requires specific optimization strategies due to its transmembrane nature. The protein is typically expressed in an in vitro E. coli expression system with an N-terminal 10xHis-tag .

Optimized expression protocol:

• Vector selection: pET-based expression vectors under T7 promoter control are recommended for high-level expression

• E. coli strain selection: BL21(DE3) or C43(DE3) strains are preferred for membrane protein expression

• Culture conditions: Growth at 25-30°C after induction (rather than 37°C) to facilitate proper folding

• Induction parameters: 0.1-0.5 mM IPTG for 16-20 hours at reduced temperature

Purification strategy:

• Membrane isolation: Gentle cell lysis followed by differential centrifugation

• Solubilization: Mild detergents (DDM, LAPAO) at critical micelle concentration

• Affinity purification: Ni-NTA chromatography using the N-terminal 10xHis-tag

• Quality assessment: Size-exclusion chromatography to ensure homogeneity

The position and length of histidine tags have been shown to significantly affect purification yield and quality in membrane proteins, as demonstrated with ADP/ATP carriers . For atpI specifically, the N-terminal 10xHis-tag provides optimal accessibility during affinity purification while minimizing interference with protein function.

What methodologies are most effective for assessing the functional activity of recombinant atpI?

Assessing the functional activity of recombinant Adiantum capillus-veneris ATP synthase subunit a requires specialized methodologies that account for its role in the ATP synthase complex. As a single subunit, atpI cannot catalyze ATP synthesis alone, necessitating either reconstitution approaches or structural integrity assessments.

Functional assessment strategies:

• Proteoliposome reconstitution:

  • Incorporate purified atpI with other ATP synthase subunits into liposomes

  • Establish a proton gradient using ionophores or light-driven systems

  • Measure ATP synthesis rates using luciferase-based assays

• Proton conductance assays:

  • Reconstitute atpI into planar lipid bilayers or proteoliposomes

  • Measure proton flux using pH-sensitive fluorescent dyes

  • Compare conductance with and without specific inhibitors

• Binding assays with ATP synthase partners:

  • Use surface plasmon resonance (SPR) to measure interaction kinetics

  • Employ microscale thermophoresis to quantify binding affinities

  • Conduct co-immunoprecipitation to verify protein-protein interactions

• Structural integrity verification:

  • Circular dichroism spectroscopy to assess secondary structure

  • Tryptophan fluorescence to evaluate tertiary fold

  • Limited proteolysis to confirm proper domain organization

These methodological approaches are informed by techniques used for other membrane proteins such as the mitochondrial ADP/ATP carrier, where stable conformations were locked using specific inhibitors for structural studies .

How does the structure and function of Adiantum capillus-veneris atpI compare to homologous proteins in other organisms?

Comparative analysis of Adiantum capillus-veneris atpI with homologous proteins reveals evolutionary conservation patterns that inform structure-function relationships. As a fern protein, A. capillus-veneris atpI represents an important evolutionary position between mosses and seed plants.

Structural comparison with homologs:

Functional implications:

The chloroplastic ATP synthase in photosynthetic organisms shares core mechanistic similarities despite sequence variations. The proton translocation function mediated by atpI remains conserved across plant lineages, though subtle structural adaptations may reflect optimization for specific environmental conditions.

Comparative studies with atpI can be approached similarly to research on other conserved plant proteins like PMI1, which has been shown to have orthologs in both monocots and dicots with conserved functional domains despite sequence divergence .

What are the challenges and solutions for incorporating recombinant atpI into functional ATP synthase complexes?

Incorporating recombinant Adiantum capillus-veneris ATP synthase subunit a into functional ATP synthase complexes presents several technical challenges, particularly due to its transmembrane nature and requirement for coordinated assembly with multiple other subunits.

Key challenges and methodological solutions:

• Maintaining native conformation:

  • Challenge: Detergent-solubilized atpI may adopt non-native conformations

  • Solution: Use of mild detergents (DDM, LAPAO) or amphipols for stabilization

  • Verification method: Conformational antibodies or tryptophan fluorescence

• Coordinated assembly with partner subunits:

  • Challenge: Sequential assembly order must be maintained

  • Solution: Controlled reconstitution with purified partner subunits in specific order

  • Verification method: Blue native PAGE to monitor complex formation

• Lipid environment requirements:

  • Challenge: Specific lipids needed for proper function

  • Solution: Inclusion of chloroplast lipids (MGDG, DGDG) in reconstitution mix

  • Verification method: Thin layer chromatography to verify lipid composition

• Proton gradient establishment:

  • Challenge: Generating stable proton gradients for functional testing

  • Solution: Co-reconstitution with light-driven proton pumps

  • Verification method: pH-sensitive fluorescent dyes to monitor gradient formation

Similar reconstitution challenges have been addressed with other membrane proteins like the mitochondrial ADP/ATP carrier, where specific inhibitors were used to stabilize certain conformations during structural studies . For atpI, stabilization may be achieved through co-expression with partner subunits or chemical cross-linking approaches.

What novel research directions involve Adiantum capillus-veneris atpI in understanding chloroplast evolution?

Recombinant Adiantum capillus-veneris ATP synthase subunit a offers unique opportunities for investigating chloroplast evolution, particularly as ferns represent an important evolutionary position between non-vascular and seed plants.

Emerging research directions:

• Evolutionary adaptation of energy coupling mechanisms:

  • Comparative functional studies between fern, algal, and angiosperm atpI

  • Identification of lineage-specific adaptations in proton translocation efficiency

  • Reconstruction of evolutionary trajectories using ancestral sequence reconstruction

• Co-evolution with nuclear-encoded ATP synthase subunits:

  • Analysis of nuclear-chloroplast genome coordination in ATP synthase assembly

  • Identification of compensatory mutations between atpI and nuclear partners

  • Development of evolutionary models for cytonuclear co-adaptation

• Structural biology approaches:

  • Cryo-EM studies of complete ATP synthase complexes with fern-specific subunits

  • Molecular dynamics simulations to understand species-specific functional adaptations

  • Structure-guided mutagenesis to identify critical residues for fern-specific functions

• Environmental adaptation studies:

  • Investigation of atpI variants from ferns in extreme environments

  • Analysis of sequence adaptations to different light conditions

  • Characterization of ATP synthase efficiency across varied ecological niches

This research can build upon methodologies used to study other chloroplast proteins like PMI1, where comparative analyses between monocots and dicots revealed conservation of specific functional domains despite substantial evolutionary distance .

What approaches can be used to determine the oligomeric state of recombinant atpI in detergent solutions?

Determining the oligomeric state of recombinant Adiantum capillus-veneris ATP synthase subunit a in detergent solutions is critical for understanding its structural organization and functional implications. Multiple complementary techniques should be employed to obtain reliable results.

Recommended methodological approaches:

• Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS):

  • Separates protein-detergent complexes by size

  • MALS provides absolute molecular weight independent of shape

  • Can distinguish between protein mass and detergent contribution

• Analytical Ultracentrifugation (AUC):

  • Sedimentation velocity experiments determine shape and size distribution

  • Sedimentation equilibrium provides absolute molecular weight information

  • Detergent matching minimizes contribution from detergent micelles

• Chemical Cross-linking coupled with Mass Spectrometry:

  • Covalent stabilization of native oligomeric states

  • MS analysis identifies cross-linked peptides

  • Provides spatial constraints for structural modeling

• Blue Native PAGE:

  • Preserves native protein interactions during electrophoresis

  • Allows comparison with known molecular weight standards

  • Can be followed by second-dimension SDS-PAGE to verify subunit composition

This multi-technique approach is similar to strategies employed for other membrane proteins like the mitochondrial ADP/ATP carrier, where the oligomeric state was initially debated until definitive structural studies were conducted .

How can researchers effectively distinguish between native and non-native conformations of recombinant atpI?

Distinguishing between native and non-native conformations of recombinant Adiantum capillus-veneris ATP synthase subunit a is essential for ensuring experimental validity. Several complementary biophysical techniques can be employed to assess conformational integrity.

Methodological approaches to assess protein conformation:

• Circular Dichroism (CD) Spectroscopy:

  • Far-UV CD (190-250 nm): Quantifies secondary structure composition

  • Near-UV CD (250-350 nm): Assesses tertiary structural environment

  • Thermal denaturation profiles monitor stability differences

• Intrinsic Fluorescence Spectroscopy:

  • Tryptophan emission maxima shift with changes in local environment

  • Quenching accessibility provides information on residue exposure

  • Time-resolved measurements detect subtle conformational differences

• Limited Proteolysis:

  • Native conformations exhibit characteristic protease resistance patterns

  • MS analysis of digestion products identifies protected regions

  • Time-course experiments reveal stability of structural domains

• Conformation-specific Antibodies:

  • Epitope mapping identifies conformation-dependent binding sites

  • ELISA or Western blot analysis quantifies conformational population

  • Competition assays determine relative affinities for different states

These approaches have been successfully applied to membrane proteins such as the mitochondrial ADP/ATP carrier, where specific inhibitors were used to stabilize distinct conformational states for structural studies .

What are the optimal approaches for studying protein-protein interactions involving atpI?

Studying protein-protein interactions involving recombinant Adiantum capillus-veneris ATP synthase subunit a requires specialized approaches that accommodate its transmembrane nature while preserving physiologically relevant interactions.

Methodological strategies for protein interaction studies:

• Co-immunoprecipitation with Crosslinking:

  • Reversible crosslinkers preserve transient interactions

  • Detergent solubilization maintains membrane protein stability

  • MS analysis identifies interaction partners and interfaces

• Bioluminescence Resonance Energy Transfer (BRET):

  • Label atpI and potential partners with luciferase and fluorescent protein

  • Measure energy transfer as indicator of proximity (<10 nm)

  • Can be performed in membrane environments or living systems

• Surface Plasmon Resonance (SPR):

  • Immobilize His-tagged atpI on Ni-NTA sensor chips

  • Flow potential interaction partners across surface

  • Obtain kinetic parameters (kon, koff, KD) for interactions

• Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Compare deuterium uptake patterns of atpI alone and in complexes

  • Identify regions with altered solvent accessibility upon binding

  • Map interaction interfaces at peptide-level resolution

These methods have been successfully applied to other membrane protein complexes and could be adapted for studying atpI interactions within the ATP synthase complex or with novel partners in signaling pathways.

How can researchers address common issues in recombinant atpI expression and purification?

Researchers working with recombinant Adiantum capillus-veneris ATP synthase subunit a frequently encounter challenges during expression and purification. The following methodological solutions address the most common issues:

Expression troubleshooting:

Purification troubleshooting:

These methodological approaches are similar to strategies used for other challenging membrane proteins like the mitochondrial ADP/ATP carrier, where optimizing purification conditions was critical for obtaining structural data .

What strategies can address the challenges of reconstituting atpI into membrane systems for functional studies?

Reconstituting recombinant Adiantum capillus-veneris ATP synthase subunit a into membrane systems presents several challenges that require methodological refinement. The following strategies can optimize success rates:

Methodological approaches for effective reconstitution:

• Lipid composition optimization:

  • Incorporate chloroplast-specific lipids (MGDG, DGDG, SQDG)

  • Test different lipid:protein ratios (typically 50:1 to 200:1)

  • Screen lipid mixtures with varying head group compositions

• Reconstitution method selection:

  • Detergent dialysis: Gradual detergent removal promotes ordered incorporation

  • Detergent adsorption: Bio-Beads SM-2 or Amberlite XAD-2 for controlled detergent removal

  • Direct incorporation: Inclusion during liposome formation (for detergent-stable proteins)

• Verification of successful incorporation:

  • Sucrose density gradient centrifugation to separate proteoliposomes from free protein

  • Freeze-fracture electron microscopy to visualize protein distribution

  • Protease protection assays to confirm correct orientation

• Functional validation approaches:

  • Proton permeability assays using pH-sensitive fluorescent dyes

  • Co-reconstitution with complementary ATP synthase subunits

  • Structural integrity verification via limited proteolysis

Similar methodological strategies have been applied to other membrane proteins like the mitochondrial ADP/ATP carrier, where reconstitution into defined lipid environments was critical for functional studies .

How can researchers address potential artifacts introduced by the His-tag in structural and functional studies?

The N-terminal 10xHis-tag used in recombinant Adiantum capillus-veneris ATP synthase subunit a can potentially introduce artifacts in structural and functional studies. The following methodological approaches can help address these concerns:

Strategies to mitigate His-tag artifacts:

• Tag removal approaches:

  • Incorporate protease cleavage sites (TEV, PreScission) between tag and protein

  • Optimize cleavage conditions to ensure complete tag removal

  • Perform secondary purification to separate cleaved protein from tag

• Control experiments to assess tag influence:

  • Compare key properties between tagged and untagged versions

  • Test multiple tag positions (N-terminal vs. C-terminal)

  • Vary tag length (6xHis vs. 10xHis) to assess impact

• Functional validation with and without tag:

  • Conduct parallel activity assays with tagged and untagged protein

  • Measure binding kinetics to partner proteins with both variants

  • Assess oligomerization state using complementary methods

• Structural studies considerations:

  • Include flexible linkers to minimize structural perturbation

  • Validate structure with orthogonal methods (CD, SAXS)

  • Use molecular dynamics simulations to assess tag influence on protein dynamics

The importance of tag position and length has been demonstrated in studies of other membrane proteins, including the ADP/ATP carrier, where optimization of these parameters significantly affected purification yield and protein quality .

How can recombinant atpI be utilized in synthetic biology applications for improved photosynthetic efficiency?

Recombinant Adiantum capillus-veneris ATP synthase subunit a offers potential applications in synthetic biology approaches aimed at enhancing photosynthetic efficiency. The following methodological strategies represent cutting-edge research directions:

Synthetic biology approaches using atpI:

• Engineering proton channeling efficiency:

  • Structure-guided mutagenesis of key residues in proton translocation pathway

  • Creation of chimeric atpI variants incorporating features from highly efficient species

  • Directed evolution to select for variants with enhanced proton conductance

• Optimization of ATP synthase assembly and stability:

  • Co-expression systems with compatible subunits to ensure proper complex formation

  • Engineering of stabilizing interactions at subunit interfaces

  • Introduction of disulfide bridges to enhance thermostability

• Integration into artificial photosynthetic systems:

  • Reconstitution with light-harvesting complexes in synthetic membranes

  • Coupling with artificial reaction centers for light-driven ATP production

  • Development of self-assembling ATP synthase arrays for enhanced spatial organization

• Adaptation to alternative energy sources:

  • Engineering atpI variants responsive to alternative ion gradients

  • Creation of hybrid systems coupling to non-photosynthetic energy sources

  • Development of atpI variants with altered regulatory properties

These advanced applications build upon fundamental understanding of chloroplast protein function, similar to how knowledge of proteins like PMI1 has advanced understanding of chloroplast movement mechanisms .

What are the emerging techniques for studying the dynamic behavior of atpI within the ATP synthase complex?

Understanding the dynamic behavior of Adiantum capillus-veneris ATP synthase subunit a within the complete ATP synthase complex requires cutting-edge methodological approaches that can capture conformational changes during the catalytic cycle.

Advanced techniques for studying atpI dynamics:

• Time-resolved Cryo-electron Microscopy:

  • Rapid freezing at defined time points after activation

  • Classification of particles into discrete conformational states

  • Construction of molecular movies depicting conformational trajectory

• Single-Molecule FRET Spectroscopy:

  • Strategic placement of fluorophore pairs to monitor distance changes

  • Real-time observation of conformational transitions

  • Correlation of conformational changes with functional states

• Hydrogen-Deuterium Exchange Mass Spectrometry with Millisecond Quench:

  • Pulse-labeling at different stages of the catalytic cycle

  • Region-specific dynamics monitoring through deuterium incorporation

  • Identification of allosteric networks through correlated exchange patterns

• Molecular Dynamics Simulations with Enhanced Sampling:

  • Construction of atomistic models in explicit membrane environments

  • Application of techniques like metadynamics to access longer timescales

  • Integration of experimental constraints from FRET or HDX-MS data

These methodological approaches represent the frontier of membrane protein dynamics research and could provide unprecedented insights into the molecular mechanism of ATP synthesis in chloroplasts.

How does the study of Adiantum capillus-veneris atpI contribute to understanding evolutionary adaptations in photosynthetic organisms?

The study of recombinant Adiantum capillus-veneris ATP synthase subunit a provides a unique window into evolutionary adaptations of the photosynthetic apparatus, particularly as ferns represent an important transitional lineage in plant evolution.

Evolutionary research applications:

• Comparative genomics and phylogenetics:

  • Sequence analysis across diverse photosynthetic lineages

  • Identification of conserved vs. variable regions correlated with ecological niches

  • Reconstruction of ancestral sequences to track evolutionary trajectories

• Structure-function relationships across evolutionary time:

  • Heterologous expression of atpI from multiple evolutionary lineages

  • Functional comparison of proton conductance and coupling efficiency

  • Identification of adaptive mutations that enhanced fitness

• Co-evolution with interacting partners:

  • Analysis of compensatory mutations between atpI and other ATP synthase subunits

  • Mapping of evolutionary rate heterogeneity across protein interaction surfaces

  • Identification of lineage-specific interaction networks

• Adaptation to environmental stressors:

  • Comparison of atpI sequences from extremophilic vs. mesophilic ferns

  • Functional characterization under varying conditions (pH, temperature, light)

  • Correlation of sequence adaptations with habitat-specific challenges

This evolutionary perspective complements research on other chloroplast proteins like PMI1, where comparative studies between monocots and dicots have revealed conservation of functional domains despite sequence divergence .