Recombinant Adiantum capillus-veneris ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Adiantum capillus-veneris (Maidenhair fern)
Target Names
atpF
Target Protein Sequence
MRSLSEIIAPSSYWTLAGTIGLNTNIFEINLINLILVLGILFYYGKGVLINLLENRERTI LNTIQDAEERHKEATEKLQRARLRLQQAEMKADEIRIIGLTKMDRERRDLVDAADNDLRE LEESKNYAIRFEKQRAIEQVRQQVSRLASERAFESLNGRLTNEFQLRMIDYHIGLLRAMA NKST
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core, and the F0 domain, containing the membrane proton channel. These domains are linked by a central and a peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits.

This protein is a component of the F0 channel, forming part of the peripheral stalk that connects F1 and F0.

Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is ATP synthase subunit b in Adiantum capillus-veneris and how does it function?

ATP synthase subunit b (atpF) is a critical component of the chloroplastic ATP synthase complex in the fern species Adiantum capillus-veneris. This protein is part of the Fo portion of the ATP synthase, which is embedded in the thylakoid membrane of chloroplasts. The subunit b functions as a peripheral stalk connecting the membrane-embedded Fo sector with the catalytic F1 sector, providing structural stability and participating in the rotational mechanism that drives ATP synthesis during photosynthesis. In ferns like Adiantum capillus-veneris, the atpF gene is encoded in the chloroplast genome and plays an essential role in photosynthetic energy production .

ATP synthase as a whole converts the proton gradient generated by light-driven electron transport into chemical energy in the form of ATP. The subunit composition of ATP synthase includes multiple components (atpA, atpB, atpE, atpF, atpH, and atpI) that work together as a molecular machine to harness the energy of proton movement across the thylakoid membrane .

How is the atpF gene organized in the chloroplast genome of ferns?

The atpF gene in ferns, including Adiantum capillus-veneris, is located in the large single-copy (LSC) region of the chloroplast genome. Analysis of fern chloroplast genomes reveals that atpF is one of several genes containing introns. Specifically, the atpF gene contains one intron, splitting the coding sequence into two exons . This intron-exon structure is conserved across multiple fern species, suggesting functional importance in gene expression regulation.

The chloroplast genomes of ferns typically exhibit a quadripartite structure consisting of large single-copy (LSC) regions (82,384–82,799 bp), small single-copy (SSC) regions (21,600–21,708 bp), and two inverted repeat (IR) regions (22,040–22,682 bp) . Within this genomic organization, the atpF gene is categorized among genes encoding subunits of ATP synthase, which are essential for photosynthetic function.

What is known about ATP synthase gene expression patterns in ferns compared to other plant groups?

ATP synthase genes in ferns show distinct expression patterns compared to those in seed plants. In ferns like Adiantum capillus-veneris, chloroplast genes including atpF demonstrate tissue-specific expression patterns, with generally higher expression in photosynthetically active tissues. Unlike angiosperms, ferns may exhibit less extensive RNA editing in ATP synthase transcripts, though C-to-U conversion remains the most common type of RNA editing event in fern chloroplast transcripts .

How does ATP synthase subunit b participate in retrograde signaling between chloroplasts and the nucleus?

While direct evidence for Adiantum capillus-veneris is limited, research on ATP synthase in other plants provides valuable insights into potential retrograde signaling mechanisms. In Arabidopsis thaliana, mitochondrial ATP synthase β-subunit mutants show impaired plastid retrograde signaling, suggesting a connection between energy production organelles and nuclear gene expression .

When ATP synthase function is compromised, changes in energy status, redox balance, and metabolite concentrations can trigger retrograde signals from chloroplasts to the nucleus. These signals modulate the expression of photosynthesis-associated nuclear genes (PhANGs). In the case of A. thaliana, mutations affecting ATP synthase led to significantly higher expression levels of PhANGs compared to wild-type seedlings when treated with lincomycin (LIN) or norflurazon (NF) .

It is hypothesized that in ferns, including Adiantum capillus-veneris, alterations in ATP synthase subunit b function may similarly affect retrograde signaling pathways. This connection potentially involves transcription factors such as MYB, WRKY, and AP2/ERF families, which regulate nuclear gene expression in response to chloroplast status .

What experimental approaches are most effective for studying the function of recombinant atpF in vitro?

To study recombinant Adiantum capillus-veneris atpF function in vitro, researchers should employ a systematic experimental design approach:

  • Expression system optimization: E. coli BL21(DE3) or similar strains with pET vectors under T7 promoter control typically provide good expression levels for chloroplast proteins. For atpF specifically, lower induction temperatures (16-18°C) often improve solubility.

  • Purification strategy: A two-step purification protocol combining immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography (SEC) is recommended for obtaining pure recombinant atpF protein.

  • Functional assays: ATP synthase activity can be assessed using:

    • Proton translocation measurements with pH-sensitive fluorescent dyes

    • ATP synthesis rates using luciferase-based luminescence assays

    • ATPase activity through phosphate release quantification

When designing these experiments, researchers must carefully define their variables :

Independent variableDependent variableControl variables
Recombinant atpF protein concentrationATP synthesis ratepH, temperature, substrate concentration
Site-directed mutations in atpFProton translocation efficiencyMembrane composition, PMF magnitude
Interaction partners (other subunits)Complex assembly efficiencyBuffer conditions, redox state

How can researchers investigate the structural dynamics of ATP synthase subunit b during the catalytic cycle?

Investigating the structural dynamics of Adiantum capillus-veneris ATP synthase subunit b during catalysis requires sophisticated biophysical approaches:

These approaches should be implemented following rigorous experimental design principles, with carefully defined dependent and independent variables, and appropriate controls to eliminate confounding factors .

What is the optimal protocol for isolating functional chloroplasts from Adiantum capillus-veneris to study native ATP synthase?

Protocol for Chloroplast Isolation from Adiantum capillus-veneris:

  • Sample preparation:

    • Harvest young fronds (preferably unfurling) in the morning when photosynthetic activity is optimal

    • Keep tissue on ice and process immediately to minimize degradation

  • Homogenization buffer composition:

    • 330 mM sorbitol

    • 50 mM HEPES-KOH (pH 7.6)

    • 1 mM MgCl₂

    • 1 mM EDTA

    • 0.1% BSA

    • 5 mM ascorbic acid (fresh)

  • Isolation procedure:

    • Homogenize tissue gently in cold buffer (4°C) using a blender with short pulses

    • Filter homogenate through four layers of cheesecloth and two layers of Miracloth

    • Centrifuge filtrate at 1,000g for 5 minutes at 4°C

    • Resuspend pellet in resuspension buffer (same as homogenization buffer without BSA)

    • Purify using Percoll gradient centrifugation (40%/80% Percoll)

  • Functionality assessment:

    • Measure chlorophyll content (expected yield: 0.5-1.0 mg chlorophyll per gram fresh weight)

    • Assess intactness using ferricyanide reduction test (>80% intact chloroplasts indicates good preparation)

    • Perform oxygen evolution measurements to confirm photosynthetic capacity

This protocol maintains the structural integrity of the thylakoid membranes, allowing for the study of ATP synthase in its native environment. The method can be verified by immunoblotting for ATP synthase subunits using specific antibodies .

How should researchers design experiments to investigate the role of atpF in photosynthetic efficiency?

When designing experiments to investigate atpF's role in photosynthetic efficiency, researchers should follow these methodological steps:

  • Hypothesis formulation: Clearly state the predicted relationship between atpF function and a specific aspect of photosynthetic efficiency. For example: "Altered expression of atpF affects the proton motive force (PMF) across thylakoid membranes and subsequently impacts photosynthetic electron transport rates."

  • Variable definition :

    Independent variableDependent variablesControl variables
    atpF expression level (wild-type, reduced, overexpressed)1. ATP synthesis rate
    2. Electron transport rate
    3. Proton gradient formation
    4. Photosynthetic quantum yield
    1. Light intensity
    2. CO₂ concentration
    3. Temperature
    4. Leaf age
    5. Water status
  • Experimental approaches:

    • RNA interference or CRISPR/Cas9 to generate atpF knockdown/knockout lines

    • Chlorophyll fluorescence measurements (PAM fluorometry) to assess photosystem II efficiency

    • Electrochromic shift (ECS) measurements to quantify PMF

    • P700 oxidation kinetics to evaluate PSI activity

    • Gas exchange measurements to determine carbon assimilation rates

  • Experimental design:

    • Use randomized complete block design with appropriate replication (minimum n=6)

    • Include proper controls (wild-type, empty vector controls)

    • Perform measurements under various light intensities to generate light response curves

    • Conduct time-course experiments to capture dynamic responses

  • Data analysis:

    • Apply appropriate statistical tests (ANOVA followed by post-hoc tests)

    • Use regression analysis to establish quantitative relationships

    • Consider principal component analysis for multivariate data

By following this structured approach, researchers can establish causal relationships between atpF function and photosynthetic performance while minimizing experimental bias and confounding variables .

What are the current approaches for analyzing protein-protein interactions involving ATP synthase subunit b in chloroplasts?

Researchers investigating protein-protein interactions involving ATP synthase subunit b in chloroplasts can employ several complementary techniques:

  • Co-immunoprecipitation (Co-IP) using antibodies against atpF or potential interacting partners:

    • Advantages: Preserves native conditions, can detect transient interactions

    • Limitations: Requires specific antibodies, may disrupt weak interactions

    • Protocol adaptation: Use mild detergents (0.5% digitonin or 1% n-dodecyl β-D-maltoside) for membrane protein solubilization

  • Yeast two-hybrid (Y2H) with membrane protein adaptations:

    • Split-ubiquitin Y2H system specifically designed for membrane proteins

    • Test against libraries of chloroplast proteins or targeted candidates

    • Control for self-activation and expression levels

  • Bimolecular Fluorescence Complementation (BiFC) in plant protoplasts:

    • Express atpF fused to N-terminal half of fluorescent protein

    • Express candidate interactors fused to C-terminal half

    • Visualize reconstituted fluorescence in chloroplasts using confocal microscopy

  • Chemical crosslinking coupled with mass spectrometry (XL-MS):

    • Use membrane-permeable crosslinkers (DSP, BS3)

    • Identify crosslinked peptides using high-resolution mass spectrometry

    • Determine interaction interfaces and spatial proximity

  • Surface Plasmon Resonance (SPR) or Microscale Thermophoresis (MST):

    • Quantitatively measure binding affinities

    • Determine association/dissociation kinetics

    • Assess effects of ATP, ADP, and other factors on interaction strength

Each technique provides complementary information about the interaction landscape of ATP synthase subunit b. A comprehensive understanding requires triangulation of results from multiple methods. Data can be organized in interaction maps showing the ATP synthase interactome within the chloroplast, with emphasis on evolutionary conservation across plant lineages including ferns like Adiantum capillus-veneris .

How can researchers overcome difficulties in expressing recombinant atpF protein?

Expression of recombinant ATP synthase subunit b often presents challenges due to its hydrophobic nature and involvement in multi-protein complexes. Here are methodological solutions to common expression issues:

  • Problem: Protein forms inclusion bodies

    • Solution: Express at lower temperatures (16°C) with reduced inducer concentration

    • Alternate approach: Use fusion partners like MBP, SUMO, or TrxA to enhance solubility

    • Test multiple E. coli strains optimized for membrane proteins (C41(DE3), C43(DE3), Lemo21(DE3))

  • Problem: Toxic to expression host

    • Solution: Use tightly regulated expression systems with glucose repression

    • Alternate approach: Consider cell-free expression systems that bypass toxicity issues

    • Implementation: Employ strains with additional rare tRNAs if codon bias is detected

  • Problem: Poor protein stability after purification

    • Solution: Optimize buffer conditions (test pH range 6.5-8.0, add glycerol 5-10%)

    • Critical factor: Include appropriate detergents (DDM, LMNG, or GDN) above their CMC

    • Stabilization approach: Add phospholipids like POPC or natural thylakoid lipids

  • Problem: Limited yield for structural studies

    • Solution: Consider heterologous expression in chloroplast transformation systems

    • Alternative: Develop insect cell expression using baculovirus systems

    • Scale-up strategy: Implement high-density fermentation with fed-batch approach

For optimal results, systematically test multiple conditions simultaneously using a design of experiments (DoE) approach to identify the key factors affecting expression. Document all optimization attempts in a structured manner to identify patterns and successful strategies for similar membrane proteins .

What strategies can be employed to study the impact of mutations in the atpF gene on ATP synthase function?

To systematically investigate how mutations in atpF affect ATP synthase function, researchers should implement the following methodological strategy:

  • Mutation design approach:

    • Use evolutionary conservation analysis across fern species to identify critical residues

    • Focus on interface regions with other subunits based on structural models

    • Create a library of mutations covering different functional domains (membrane-spanning, stalk, oligomerization)

  • Mutation categories to investigate:

    Mutation typeTarget residuesExpected functional impact
    Conservative substitutionsHydrophobic coreMinimal structural changes
    Charge reversalsInterface regionsDisrupted subunit interactions
    Deletion mutantsTerminal regionsAltered assembly dynamics
    Cysteine substitutionsThroughout sequenceProbes for disulfide crosslinking
  • Functional analysis pipeline:

    • Complementation assays in bacterial ATP synthase mutants

    • In vitro reconstitution of ATP synthase complexes with mutant subunits

    • Proton pumping measurements in proteoliposomes

    • ATP synthesis/hydrolysis kinetics with purified enzyme complexes

  • Structure-function correlation:

    • Map mutation effects onto structural models

    • Use molecular dynamics simulations to predict structural perturbations

    • Correlate biophysical measurements with structural changes

When interpreting results, researchers should distinguish between mutations affecting:

  • Protein stability and folding

  • Subunit assembly into the complete complex

  • Proton translocation efficiency

  • Mechanical coupling between Fo and F1 domains

  • Regulatory interactions with other cellular components

How might comparative studies between fern and angiosperm ATP synthase advance our understanding of photosynthetic evolution?

Comparative studies between Adiantum capillus-veneris (fern) and angiosperm ATP synthase offer significant potential for understanding photosynthetic evolution. Ferns occupy an evolutionary position between bryophytes and seed plants, potentially preserving intermediate characteristics of photosynthetic machinery.

Key research approaches should include:

  • Phylogenomic analysis: Compare atpF sequences across diverse plant lineages to identify:

    • Conserved functional domains maintained through 400+ million years of evolution

    • Lineage-specific adaptations in ferns versus angiosperms

    • Correlation between sequence changes and habitat adaptation (shade tolerance in ferns)

  • Structural biology investigations:

    • Solve high-resolution structures of ATP synthase from representative species

    • Compare subunit interfaces and interactions that may reflect different regulatory mechanisms

    • Analyze rotational dynamics and energy coupling efficiency across evolutionary lineages

  • Comparative biochemistry:

    • Measure ATP synthesis rates under varying conditions (light intensity, temperature)

    • Determine pH and ion dependencies that may reflect adaptation to different environments

    • Assess regulatory mechanisms and their evolutionary conservation

This research would provide insights into how photosynthetic efficiency has been modulated through plant evolution and how ferns like Adiantum capillus-veneris maintain efficient photosynthesis despite lacking some of the advanced regulatory mechanisms found in angiosperms. The findings could also inform bioengineering efforts to enhance photosynthetic efficiency in crops .

What role might ATP synthase play in the adaptation of Adiantum capillus-veneris to diverse environmental conditions?

Adiantum capillus-veneris is notable for its ability to thrive in diverse habitats ranging from moist, shaded environments to relatively drier conditions. ATP synthase likely plays a crucial role in this adaptability through several mechanisms:

  • Shade adaptation mechanisms:

    • Optimized ATP synthesis under low light conditions

    • Modified proton/ATP ratios that maximize energy capture efficiency

    • Structural adaptations that maintain functionality despite limited energy input

  • Response to water availability fluctuations:

    • Potential for ATP synthase regulation during drought stress

    • Altered coupling efficiency during environmental stress

    • Interaction with stress signaling pathways via retrograde signaling

  • Temperature adaptation strategies:

    • Thermal stability modifications in protein structure

    • Different isoforms or post-translational modifications optimized for temperature ranges

    • Altered lipid-protein interactions in the thylakoid membrane affecting ATP synthase function

Experimental approaches to investigate these adaptations should include:

  • Comparative physiological measurements across populations from different habitats

  • Expression analysis under controlled environmental stresses

  • Proteomics to identify post-translational modifications associated with environmental adaptation

  • Reconstruction of ancestral sequences to track evolutionary changes in response to habitat shifts

Understanding how ATP synthase contributes to environmental adaptation in Adiantum capillus-veneris could provide insights into mechanisms of plant resilience to environmental change and inform conservation strategies for threatened fern species .

How can researchers integrate transcriptomic, proteomic, and physiological data to better understand atpF function?

To comprehensively understand atpF function in Adiantum capillus-veneris, researchers should implement a multi-omics integration approach using the following methodology:

  • Data collection and standardization:

    • RNA-seq under various conditions (developmental stages, light regimes, stress)

    • Proteomics focusing on post-translational modifications and protein complexes

    • Physiological measurements (photosynthetic parameters, growth, stress responses)

    • Ensure comparable sampling strategies across all techniques

  • Integration methods:

    Data typeAnalysis approachExpected insights
    TranscriptomicsDifferential expression, co-expression networksRegulatory patterns, transcriptional control
    ProteomicsProtein abundance, PTMs, interactome mappingPost-transcriptional regulation, protein interactions
    MetabolomicsEnergy metabolites, redox statusFunctional impacts on cellular metabolism
    Physiological dataPhotosynthetic parameters correlationPhenotypic consequences of molecular changes
  • Integration platforms and algorithms:

    • Use machine learning approaches (random forest, support vector machines) to identify predictive features

    • Apply weighted gene co-expression network analysis (WGCNA) to identify functional modules

    • Implement Bayesian network analysis to infer causal relationships

    • Develop visualization tools that combine multiple data types on metabolic maps

  • Validation strategies:

    • Test predictions using reverse genetics approaches

    • Verify protein interactions using orthogonal methods

    • Confirm physiological impacts through detailed phenotyping

The integrated analysis should specifically address how atpF expression correlates with other ATP synthase subunits, how post-translational modifications affect enzyme function, and how environmental factors modulate the entire ATP synthase complex. This systems biology approach provides a comprehensive view of atpF function beyond what any single technique could reveal .

What computational approaches best predict the impact of sequence variations in atpF on ATP synthase function?

Predicting how sequence variations in Adiantum capillus-veneris atpF affect ATP synthase function requires sophisticated computational approaches:

  • Homology modeling and molecular dynamics:

    • Generate structural models based on crystal structures from related organisms

    • Perform extensive molecular dynamics simulations (>100 ns) to assess stability

    • Calculate free energy of folding for variants using methods like FoldX or Rosetta

    • Analyze trajectory data for changes in flexibility, secondary structure, or domain movements

  • Evolutionary coupling analysis:

    • Use methods like Direct Coupling Analysis (DCA) or Statistical Coupling Analysis (SCA)

    • Identify co-evolving residue networks that maintain function

    • Predict functional impact of variations based on evolutionary conservation patterns

    • Incorporate data from diverse fern species to strengthen predictions

  • Machine learning approaches:

    • Train models using known structure-function relationships in ATP synthase

    • Apply ensemble methods combining multiple prediction algorithms

    • Use feature selection to identify the most informative sequence properties

    • Validate predictions with experimental mutagenesis data

  • Network-based approaches:

    • Model the entire ATP synthase complex as an interaction network

    • Analyze how mutations propagate effects through the protein interaction network

    • Identify allosteric pathways affected by sequence variations

    • Predict emergent properties of the complex based on component modifications

The accuracy of these computational predictions should be assessed by systematic comparison with experimental data. For atpF specifically, predictions should focus on:

These computational approaches provide testable hypotheses about structure-function relationships in ATP synthase and guide experimental design for functional studies of specific variants .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.