Recombinant Adiantum capillus-veneris Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Adiantum capillus-veneris (Maidenhair fern)
Target Names
petD
Target Protein Sequence
MGVKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTVACTVGLAVLEPSM VGEPANPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMASVPAGLLTVPFLENVNKFQ NPFRRPVATTVFAIGTVAAIWLGIGATLPIEGSLTLGLF
Uniprot No.

Target Background

Function

Recombinant Adiantum capillus-veneris Cytochrome b6-f complex subunit 4 (petD): A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Cytochrome b6-f complex and what role does subunit 4 (petD) play?

The Cytochrome b6-f complex functions as a crucial component in the photosynthetic electron transport chain, serving as an electron transfer complex in both linear and cyclic electron flow pathways. It exists as an eight subunit, 220 kDa symmetric dimeric complex that has been extensively characterized in various photosynthetic organisms including cyanobacteria and green algae . The complex operates as a plastoquinol-plastocyanin oxidoreductase, facilitating electron transfer between photosystem II and photosystem I.

The petD gene encodes subunit 4 of this complex, which is essential for proper complex assembly and function. In Adiantum capillus-veneris, the full-length petD protein consists of 159 amino acids and contributes to the core structure that facilitates the coupling of electron and proton transfer across the thylakoid membrane . As part of the transmembrane domain of the complex, petD plays a critical role in plastoquinone binding and processing, which is central to the modified Q-cycle mechanism employed by the complex during photosynthesis .

How is recombinant Adiantum capillus-veneris Cytochrome b6-f complex subunit 4 typically expressed?

Expression of recombinant Adiantum capillus-veneris Cytochrome b6-f complex subunit 4 is typically achieved using E. coli as the host organism, employing specialized expression systems like the pET vector system . This system utilizes the bacteriophage T7 promoter for controlled and high-level protein expression.

A typical expression protocol involves:

  • Cloning: The petD gene is cloned into a pET vector with an N-terminal His-tag sequence.

  • Transformation: The recombinant plasmid is transformed into an E. coli strain that carries the T7 RNA polymerase gene under the control of the lacUV5 promoter (such as BL21(DE3)) .

  • Culture and Induction: Bacterial cultures are grown to an appropriate density before induction with IPTG (isopropyl β-D-1-thiogalactopyranoside), which activates the T7 RNA polymerase expression.

  • Protein Accumulation: Under optimal conditions, the recombinant protein can comprise up to half of the cell's total protein content within just a few hours of induction .

  • Harvest and Lysis: Cells are harvested by centrifugation and lysed using mechanical or chemical methods to release the recombinant protein.

This expression system provides tight control over protein production, reducing toxicity issues while allowing for high yield production of the target protein when required for experimental applications.

What purification strategies are most effective for recombinant petD proteins?

Purification of recombinant His-tagged Adiantum capillus-veneris petD protein typically employs a multi-step strategy centered around immobilized metal affinity chromatography (IMAC):

  • Initial Capture: IMAC using Ni²⁺ or Co²⁺ resin exploits the high affinity of the His-tag for divalent metal ions. This step effectively separates the target protein from the majority of E. coli host proteins .

  • Intermediate Purification: Following IMAC, additional purification steps may include:

    • Ion exchange chromatography to remove contaminants with different charge properties

    • Hydrophobic interaction chromatography for separating proteins based on surface hydrophobicity

  • Polishing: Final purification often utilizes size exclusion chromatography to:

    • Remove protein aggregates

    • Exchange buffer to final storage conditions

    • Verify protein homogeneity

A typical purification workflow with experimentally determined conditions:

Purification StepBuffer CompositionElution ConditionsResult
IMAC50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazoleLinear gradient to 250 mM imidazole~70% purity
Ion Exchange20 mM Tris-HCl pH 8.0, 50 mM NaClLinear gradient to 500 mM NaCl~85% purity
Size Exclusion20 mM Tris-HCl pH 8.0, 150 mM NaClIsocratic>90% purity

For recombinant membrane proteins or protein complexes like cytochrome b6-f components, the addition of appropriate detergents during purification is critical to maintain structural integrity and function. The purified protein is typically stored in a stabilizing buffer containing 6% trehalose at pH 8.0, with addition of 5-50% glycerol for long-term storage at -20°C/-80°C .

What functional assays can be used to verify the activity of recombinant petD?

Verifying the functionality of recombinant petD requires assays that assess both its structural integration into the cytochrome b6-f complex and the electron transfer activity of the assembled complex. Several complementary approaches provide comprehensive functional characterization:

  • Spectroscopic Analysis:

    • UV-visible spectroscopy monitors characteristic absorption peaks of oxidized and reduced forms

    • Difference spectra between oxidized (ferricyanide-treated) and reduced (dithionite-treated) samples reveal functional heme incorporation

    • EPR (Electron Paramagnetic Resonance) spectroscopy at low temperatures (10K) identifies proper redox center formation

  • Electron Transfer Activity Measurement:

    • Cytochrome b6-f-mediated reduction of plastocyanin (PC) using decylplastoquinol (dPQH₂) as substrate

    • Typical reaction conditions include 20 mM Tris-HCl pH 7.5, 50 μM PC, 25 μM dPQH₂, and nanomolar concentrations of cytochrome b6-f complex

    • Activity monitored spectrophotometrically by tracking PC reduction rate (initial slope)

    • Functional recombinant complex typically exhibits turnover rates of approximately 120 reactions per second

  • Inhibitor Binding Studies:

    • Examining sensitivity to specific inhibitors like NQNO or tridecyl-stigmatellin

    • Inhibitor binding measured through changes in spectroscopic properties or activity reduction

    • Competitive binding assays with plastoquinone analogues

  • Structural Integration Assessment:

    • Size exclusion chromatography to verify incorporation into the multi-subunit complex

    • Blue native PAGE to analyze intact complex formation

    • Cryo-EM analysis to confirm proper integration of petD within the complex

These complementary approaches provide a comprehensive assessment of both the structural and functional integrity of recombinant petD within the cytochrome b6-f complex.

How can the purity of recombinant petD be assessed?

Assessment of recombinant petD purity requires a multi-method approach to ensure both structural homogeneity and functional integrity. The following analytical techniques provide complementary information about protein purity:

  • Gel-Based Methods:

    • SDS-PAGE serves as the primary purity assessment tool, with >90% purity standard for most applications

    • Coomassie or silver staining visualizes protein bands with different detection sensitivities

    • Western blotting using anti-His antibodies confirms identity and integrity of the His-tagged protein

    • Native PAGE evaluates conformational homogeneity under non-denaturing conditions

  • Chromatographic Methods:

    • Size exclusion chromatography (SEC) analyzes:

      • Monodispersity (single, symmetric peak indicates homogeneity)

      • Absence of aggregates or degradation products

      • Calibrated columns can estimate molecular weight

    • Reverse-phase HPLC assesses hydrophobic heterogeneity

    • Ion exchange chromatography evaluates charge homogeneity

  • Spectroscopic Methods:

    • UV-Vis absorption spectrum provides characteristic profiles

    • Ratio of absorbance at 280nm to absorbance at specific wavelengths for heme groups indicates proper cofactor incorporation

    • Mass spectrometry confirms:

      • Correct molecular weight

      • Sequence identity

      • Post-translational modifications

      • Degradation analysis

  • Purity Assessment Criteria:

MethodAcceptance CriteriaSensitivity
SDS-PAGE>90% single band~0.1 μg protein
Western BlotSingle band at expected MW~10 ng protein
SEC>95% main peak areaConcentration dependent
Mass Spectrometry>95% expected massPicomole range

For recombinant membrane proteins like petD, additional criteria include proper folding assessment through spectroscopic techniques and functional assays to ensure that the purified protein is not only structurally pure but also functionally active.

What role does petD play in the electron transfer mechanism of the Cytochrome b6-f complex?

The petD subunit (subunit 4) plays critical roles in the electron transfer mechanism of the Cytochrome b6-f complex through several structural and functional contributions:

The electron transfer pathway in the cytochrome b6-f complex involves intricate coordination between multiple redox centers, with petD providing critical structural elements that position these centers for optimal electron transfer efficiency while maintaining regulatory control over different electron flow pathways.

How can site-directed mutagenesis of petD help elucidate its function in the Cytochrome b6-f complex?

Site-directed mutagenesis represents a powerful approach for dissecting the structure-function relationship of petD within the Cytochrome b6-f complex. Strategic mutation of specific residues can provide insights into multiple aspects of petD function:

  • Mapping Critical Functional Domains:

    • Alanine-scanning mutagenesis of conserved residues can identify amino acids essential for:

      • Complex assembly and stability

      • Quinone binding and processing

      • Electron transfer efficiency

      • Interaction with other subunits

  • Electron Transfer Pathway Analysis:

    • Mutations of residues near heme groups can alter distance or orientation of redox centers

    • The effect on electron transfer rates can be measured using the plastocyanin reduction assay described in previous sections

    • Comparison of electron transfer rates between wild-type and mutant proteins reveals the contribution of specific residues

  • Experimental Approach:

StepMethodologyExpected Outcome
Mutant DesignPCR-based all-recombinant cloning Mutant petD genes in expression vectors
ExpressionpET system in E. coli Recombinant mutant proteins
PurificationIMAC and additional chromatographyPurified mutant proteins
Functional AnalysisSpectroscopy and activity assays Quantitative effect of mutations
Structural AnalysisCryo-EM or X-ray crystallographyStructural consequences of mutations
  • Investigation of Quinone Binding Sites:

    • Mutations in regions implicated in quinone binding can alter:

      • Binding affinity for plastoquinone

      • Sensitivity to inhibitors like NQNO or tridecyl-stigmatellin

      • Efficiency of quinone/quinol exchange

    • These studies can test the "one-way traffic model" proposed for quinone movement through the complex

  • Regulatory Mechanism Analysis:

    • Mutations targeting the interface between petD and other subunits can reveal how structural changes might regulate the balance between cyclic and noncyclic electron flow

    • Comparison of mutant activities under different physiological conditions can identify regulatory switches

This systematic mutagenesis approach provides mechanistic insights impossible to obtain through structural studies alone, revealing the dynamic functional roles of petD within the complex photosynthetic electron transport system.

What are the implications of structural studies of petD for understanding photosynthetic electron transport?

High-resolution structural studies of cytochrome b6-f complex, including the petD subunit, have revolutionized our understanding of photosynthetic electron transport in several fundamental ways:

  • Novel Electron Transfer Pathways:

    • Structural data has revealed the unique architecture of the b6-f complex compared to the related bc₁ complex

    • The discovery of heme cn (unique to b6-f) has led to a revised "modified Q cycle" model for electron transfer

    • Crystal structures with quinone analogue inhibitors show these compounds binding as ligands to heme cn, implicating this feature in n-side plastoquinone reduction

  • Quinone Channel Discovery:

    • High-resolution cryo-EM structures have revealed three plastoquinones aligned "head to tail" near the Qp site

    • This unexpected arrangement suggests a "one-way traffic model" for quinone/quinol movement through the complex

    • This model explains how efficient quinol oxidation occurs during photosynthesis and provides new insights into the mechanism of the Q-cycle

  • Evolutionary Insights:

    • Structural conservation between b6-f and bc₁ complexes reveals evolutionary relationships between photosynthetic and respiratory electron transport chains

    • Conservation of "the hydrophobic heme-binding transmembrane domain of the cyt b polypeptide" and "the rubredoxin-like membrane proximal domain of the Rieske [2Fe-2S] protein" highlights functional convergence despite divergent sequences

  • Regulatory Mechanisms:

    • Structural details provide insights into how the complex might regulate "the relative rates of noncyclic and cyclic electron transfer"

    • Understanding these regulatory mechanisms is crucial for explaining how photosynthetic organisms balance energy production under varying environmental conditions

  • Practical Applications:

    • Detailed structural knowledge enables rational design of herbicides targeting specific binding sites

    • Understanding the mechanistic details of photosynthetic electron transport provides a foundation for engineering improved photosynthetic efficiency in crops

    • Biomimetic approaches for artificial photosynthesis can be informed by the structural details of natural electron transport complexes

These structural insights have transformed our understanding from a simplified linear model of electron flow to a sophisticated appreciation of the dynamic, regulated processes that optimize photosynthetic efficiency under diverse environmental conditions.

How can recombinant petD be used in studies of cyclic electron flow in photosynthesis?

Recombinant petD provides a versatile tool for investigating cyclic electron flow (CEF) in photosynthesis through multiple experimental approaches:

  • Reconstitution Studies:

    • Incorporation of purified recombinant petD into:

      • Liposomes with other purified components of electron transport chain

      • Thylakoid membranes depleted of native cytochrome b6-f complex

      • Artificial membrane systems

    • Measurement of CEF rates under controlled conditions allows assessment of petD's specific contribution to this pathway

    • Comparison of wild-type versus mutant petD reveals structure-function relationships specific to CEF

  • Interaction Studies with CEF Components:

    • Identification of protein-protein interactions between recombinant petD and other components specific to CEF:

      • Ferredoxin

      • NADPH dehydrogenase-like complex (NDH)

      • PROTON GRADIENT REGULATION5 (PGR5) and PGR5-LIKE1 (PGRL1) proteins

    • Methods include co-immunoprecipitation, surface plasmon resonance, and isothermal titration calorimetry

    • These studies can reveal unique interactions required for CEF that differ from linear electron flow

  • Experimental Workflow for CEF Investigation:

StepMethodologyMeasurements
Protein PreparationExpression in E. coli using pET system Purity >90% by SDS-PAGE
CEF ReconstitutionIncorporation into proteoliposomes with PSI, Fd, FNRSpectroscopic verification
Activity AssayCyclic electron flow measurementP700 re-reduction kinetics
Interaction AnalysisPull-down assays with CEF componentsBinding constants
Structure-FunctionMutational analysis of interaction domainsEffect on CEF rates
  • Regulation Studies:

    • Investigation of how post-translational modifications of petD affect CEF:

      • Phosphorylation sites can be mimicked through site-directed mutagenesis

      • Redox-sensitive residues can be modified to understand regulation under different light conditions

    • These studies address how the "regulation of the relative rates of noncyclic and cyclic electron transfer" occurs at the molecular level

  • Application to Stress Responses:

    • CEF increases under various stress conditions (high light, drought, etc.)

    • Recombinant petD can be used to study how structural changes or modifications to the cytochrome b6-f complex modulate CEF under stress

    • This approach bridges fundamental research and agricultural applications by addressing how plants balance energy production under adverse conditions

These approaches collectively provide mechanistic insights into how petD contributes to the differential regulation of linear versus cyclic electron flow, a fundamental aspect of photosynthetic energy balance.

What advanced biophysical techniques are most informative for studying petD interactions within the Cytochrome b6-f complex?

Understanding the dynamic interactions of petD within the Cytochrome b6-f complex requires sophisticated biophysical approaches that probe structure, dynamics, and function across multiple spatial and temporal scales:

  • High-Resolution Structural Techniques:

    • Cryo-Electron Microscopy (Cryo-EM):

      • Achieves near-atomic resolution (2-3Å) of intact complex

      • Captures different conformational states

      • Recent advances have revealed "three plastoquinones...visible and line up one after another"

      • Optimal acquisition parameters: 300 kV acceleration voltage, 105,000× magnification, 0.86 Å/pixel

    • X-ray Crystallography:

      • Provides atomic-level detail of protein-cofactor interactions

      • Allows visualization of bound inhibitors or substrates

      • Has revealed key structural features of the cytochrome b6-f complex

  • Spectroscopic Methods for Redox Center Analysis:

    • Electron Paramagnetic Resonance (EPR) Spectroscopy:

      • Probes electronic states of paramagnetic centers (hemes, iron-sulfur clusters)

      • Conducted at cryogenic temperatures (10K)

      • Optimal parameters: microwave frequency 9.39 GHz, microwave power 6.35 mW

    • Optical Absorption Spectroscopy:

      • Monitors redox state changes in real-time

      • Differentiates multiple cytochrome components

      • Used for kinetic analysis of electron transfer reactions

  • Dynamic Interaction Techniques:

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

      • Maps protein-protein interaction interfaces

      • Identifies regions with altered solvent accessibility upon complex formation

      • Reveals dynamic structural changes during function

    • Förster Resonance Energy Transfer (FRET):

      • Measures distances between labeled components

      • Captures dynamic conformational changes

      • Can be performed in reconstituted systems or intact membranes

  • Functional Integration Methods:

    • Advanced Spectroelectrochemistry:

      • Combines electrochemistry with spectroscopy

      • Controls redox potentials while monitoring spectral changes

      • Determines redox properties of individual components within the complex

    • Time-Resolved Spectroscopy:

      • Captures electron transfer events on microsecond to picosecond timescales

      • Follows sequential redox changes through the complex

      • Correlates structural features with kinetic parameters

  • Computational Integration:

    • Molecular dynamics simulations utilizing structural data

    • Quantum mechanical calculations of electron transfer pathways

    • These computational approaches bridge experimental data to create comprehensive models of petD function

When applied in combination, these techniques provide multiscale insights into how petD contributes to the structure, function, and regulation of the cytochrome b6-f complex, yielding a dynamic picture of its role in photosynthetic electron transport that extends beyond static structural snapshots.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.