Recombinant Adiantum capillus-veneris Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal results, centrifuge the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please let us know, and we will prioritize the development of that tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Adiantum capillus-veneris (Maidenhair fern)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQIATGFAMTFYYRP TVTEAFSSVQYIMTEVNFGWLIRSVHRWSASMMVLVMILHVFRVYLTGGFKKPRELTWVT GVILAVLTVSFGVTGYSLPWDQIGYWAVKIVTGVPEAIPFIGSSLVELLRGSVSVGQSTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 is a component of the cytochrome b6-f complex, which plays a vital role in mediating electron transfer between photosystem II (PSII) and photosystem I (PSI). It also participates in cyclic electron flow around PSI and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the petB gene in Adiantum capillus-veneris?

The petB gene is located in the chloroplast genome of Adiantum capillus-veneris. The complete chloroplast genome of this fern is 150,568 bp, consisting of a large single-copy region (LSC) of 82,282 bp, a small single-copy region (SSC) of 21,392 bp, and inverted repeats (IR) of 23,447 bp each . The petB gene, encoding cytochrome b6, is part of the electron transport machinery involved in photosynthesis. Understanding this genomic context is essential for designing primers and expression strategies for recombinant production of this protein.

How does cytochrome b6 function in the photosynthetic electron transport chain of ferns compared to higher plants?

Cytochrome b6, as part of the cytochrome b6-f complex, mediates electron transfer between photosystem II and photosystem I in the thylakoid membrane. In ferns like Adiantum capillus-veneris, the basic function appears similar to higher plants, but there may be subtle differences in regulation and efficiency related to their evolutionary position. The complete chloroplast genome sequence of Adiantum capillus-veneris provides crucial information for comparative analyses with other plant groups . These comparisons have revealed that while the core function is conserved, regulatory elements and some structural features may differ, reflecting adaptations to different light environments.

What are the structural characteristics of Adiantum capillus-veneris cytochrome b6?

Cytochrome b6 from Adiantum capillus-veneris is a membrane-embedded protein with multiple transmembrane domains. While specific structural data for the Adiantum version is limited, it likely shares key features with other plant cytochrome b6 proteins, including heme binding domains and interaction sites with other components of the b6-f complex. The protein is encoded by the petB gene in the chloroplast genome, which has been completely sequenced in this species . The conservation of functional domains across evolutionary distance suggests critical roles in electron transport.

What expression systems are most effective for producing recombinant Adiantum capillus-veneris cytochrome b6?

Based on experimental approaches with similar cytochrome proteins, several expression systems can be considered:

Expression SystemAdvantagesLimitationsSpecial Considerations
E. coli membranesHigh yield, cost-effectiveMay lack proper post-translational modificationsRequires reconstitution with NADPH:CYP reductase
Baculovirus-infected insect cellsBetter protein folding, supports membrane proteinsMore complex, higher costCan include cytochrome b5 for enhanced activity
Liposome-based reconstitutionControlled membrane environmentTechnical complexityOptimal for functional studies

For membrane proteins like cytochrome b6, expressing functional protein often requires systems that can properly insert the protein into membranes. The Baculovirus-infected insect cell system (SupersomesTM) has shown particular effectiveness for cytochrome proteins, especially when co-expressed with partner proteins like cytochrome b5 .

What purification strategies optimize yield and activity of recombinant cytochrome b6?

Purification of recombinant cytochrome b6 requires specialized approaches due to its membrane-embedded nature. A successful strategy involves:

  • Detergent solubilization using mild detergents like n-dodecyl-β-D-maltoside

  • Affinity chromatography, often utilizing histidine tags

  • Size exclusion chromatography for final purification

  • Reconstitution into liposomes for functional assays

When purifying cytochrome proteins, maintaining the native heme environment is critical. Studies with similar cytochromes have shown that reconstitution with NADPH:CYP reductase and cytochrome b5 in liposomes can preserve activity . The ratio of cytochrome to reductase (typically 1:1 or 1:4) significantly impacts the activity of the purified protein.

How can researchers verify the functional integrity of recombinant cytochrome b6?

Verification of functional integrity requires multiple approaches:

  • Spectroscopic analysis: Absorption spectra to confirm proper heme incorporation (peaks at ~430 nm and ~560 nm)

  • Electron transfer assays: Using artificial electron donors/acceptors

  • Reconstitution experiments: Assembly with other components of the b6-f complex

  • Inhibitor binding studies: Using known inhibitors of the cytochrome b6-f complex

Similar to experimental approaches used with cytochrome P450, enzymatic activity can be measured by monitoring substrate oxidation or reduction of electron acceptors . The presence of cytochrome b5 can significantly enhance electron transfer efficiency in reconstituted systems, increasing activity by 2-3 fold.

How does light regulation affect cytochrome b6 activity in Adiantum capillus-veneris?

Adiantum capillus-veneris shows sophisticated light-sensing mechanisms that may influence cytochrome b6 activity. This fern possesses multiple photoreceptors, including cryptochromes (CRY3, CRY4, CRY5) and phytochromes (Acphy1, Acphy2) . Studies have demonstrated that blue light can irreversibly prevent gene expression that was induced by red light, suggesting complex photoreceptor interactions . Chloroplast movement in Adiantum prothallial cells is induced by high-fluence blue microbeam, indicating that light quality directly affects organelle positioning and potentially electron transport efficiency .

What role does cytochrome b6 play in the unique phototropic responses of Adiantum capillus-veneris?

Adiantum capillus-veneris exhibits distinct phototropic responses including polarotropism in protonemata, which is mediated by phytochrome . While the direct involvement of cytochrome b6 is not fully characterized, its function in the electron transport chain likely supports these energy-demanding directional growth responses. The difference in far-red-absorbing form of phytochrome (Pfr) between the extreme tip and subapical region appears crucial in regulating growth direction . This spatial regulation of photoreceptors may also influence the distribution and activity of photosynthetic machinery, including cytochrome b6-f complexes.

How do blue light photoreceptors interact with photosynthetic apparatus including cytochrome b6-f complex?

In Adiantum capillus-veneris, blue light photoreceptors like cryptochromes (CRY4 and CRY5) mediate various responses including inhibition of spore germination . The intracellular distribution of these photoreceptors shows that some localize to the nucleus in a light-dependent manner. GUS-CRY3 and GUS-CRY4 fusion proteins have been observed in fern gametophyte nuclei, with GUS-CRY3 showing light-regulated nuclear localization . This nuclear localization suggests that these photoreceptors may regulate gene expression, potentially including chloroplast-targeted proteins that interact with the cytochrome b6-f complex. The signal transduction pathways for high-fluence responses (HFR) and low-fluence responses (LFR) appear distinct, suggesting multiple regulatory mechanisms affecting photosynthetic efficiency .

What approaches can be used to study the interaction between cytochrome b6 and other components of the electron transport chain?

Several advanced techniques can be employed:

  • Co-immunoprecipitation with tagged recombinant proteins

  • Surface plasmon resonance for binding kinetics

  • Förster resonance energy transfer (FRET) for proximity analysis

  • Cryo-electron microscopy for structural characterization of complexes

  • Cross-linking mass spectrometry for interaction sites

When studying membrane protein interactions, reconstitution in liposomes provides a controlled environment. For cytochrome proteins, reconstitution with NADPH:CYP reductase has proven effective for functional studies . The presence of additional components like cytochrome b5 can significantly alter interaction dynamics and should be considered in experimental design.

How can researchers investigate post-translational modifications of Adiantum capillus-veneris cytochrome b6?

Post-translational modifications (PTMs) of cytochrome b6 may include:

  • Heme attachment

  • Phosphorylation

  • Acetylation

  • Redox-sensitive modifications

Investigation approaches include:

TechniqueApplicationAdvantagesLimitations
Mass spectrometryIdentification of PTM sitesHigh sensitivity, comprehensiveSample preparation challenges for membrane proteins
Site-directed mutagenesisFunctional significance of PTMsDirect causality testingLabor intensive
Phospho-specific antibodiesDetection of phosphorylationIn situ detection possibleRequires specific antibody development
2D gel electrophoresisVisualization of modified variantsSeparates different protein formsLimited resolution for membrane proteins

When developing these methodologies, researchers should consider that membrane proteins like cytochrome b6 require specialized extraction and handling protocols to maintain structural integrity while enabling accurate PTM detection.

What are the approaches for studying the evolution of petB across fern lineages compared to other plant groups?

Evolutionary analyses of petB can employ:

  • Comparative genomics using complete chloroplast sequences

  • Selection pressure analysis (dN/dS ratios)

  • Ancestral sequence reconstruction

  • Structural modeling of evolutionary variants

  • Heterologous expression of ancestral or variant forms

The complete chloroplast genome of Adiantum capillus-veneris (150,568 bp) provides a valuable reference point for such analyses . Comparing the gene organization and sequence with other plant groups can reveal conservation patterns and evolutionary adaptations. Since Adiantum belongs to Pteridaceae within a large clade of recently derived leptosporangiate families (which includes the majority of fern species), it serves as an important evolutionary link between early land plants and seed plants .

How can researchers overcome expression challenges when working with recombinant Adiantum cytochrome proteins?

Common challenges and solutions include:

  • Inclusion body formation in bacterial systems

    • Solution: Use lower induction temperatures (16-20°C)

    • Alternative: Express in membrane fractions rather than attempting soluble expression

  • Poor heme incorporation

    • Solution: Supplement growth media with δ-aminolevulinic acid

    • Alternative: Co-express heme biosynthesis or incorporation machinery

  • Low functional yield

    • Solution: Consider membrane-based expression systems like those used for cytochrome P450 proteins

    • Alternative: Use fusion tags that enhance membrane targeting

  • Protein instability

    • Solution: Include protease inhibitors throughout purification

    • Alternative: Engineer constructs with stabilizing mutations or domains

Experience with cytochrome P450 expression suggests that co-expression with cytochrome b5 can significantly enhance both expression and activity of cytochrome proteins in heterologous systems .

What are the common pitfalls in functional assays for cytochrome b6 and how can they be addressed?

Several challenges affect functional characterization:

PitfallCauseSolution
Low activityImproper reconstitutionOptimize lipid composition and protein:lipid ratios
Inconsistent resultsIncomplete reduction/oxidationEnsure complete redox cycling with appropriate reagents
Poor signal-to-noiseBackground oxidationUse anaerobic conditions and include radical scavengers
Activity loss during storageProtein denaturationStore as concentrated aliquots with glycerol at -80°C
Non-specific interactionsImpurities in preparationEnhance purification with additional chromatography steps

When designing functional assays, researchers should consider that different experimental systems (microsomes, bacterial membranes, reconstituted liposomes) show varying efficiency in supporting cytochrome activity. SupersomesTM containing human CYP3A4 and cytochrome b5 have demonstrated high efficiency in similar experimental systems .

How should researchers interpret contradictory results when comparing in vitro and in vivo studies of cytochrome function?

When facing contradictory results:

  • Examine system complexity differences

    • In vitro systems lack the complete cellular context

    • Consider reconstituting with additional components like cytochrome b5

  • Evaluate protein modification status

    • In vivo systems may provide post-translational modifications absent in vitro

    • Verify protein state using mass spectrometry or other analytical methods

  • Consider light and environmental factors

    • Adiantum shows complex light responses that may affect results

    • Control for light conditions in both systems

  • Assess redox environment differences

    • Cellular redox buffering differs from in vitro conditions

    • Modify buffers to better mimic cellular redox environment

  • Analyze interaction partners

    • In vivo systems contain the complete complement of interaction partners

    • Consider adding known interactors to in vitro systems

Studies with cytochrome proteins have shown that the presence of accessory proteins like cytochrome b5 can dramatically alter activity and substrate specificity in reconstituted systems, potentially explaining discrepancies between different experimental approaches .

What emerging technologies might advance research on Adiantum cytochrome b6?

Several emerging technologies hold promise:

  • Cryo-EM for membrane protein complexes

    • Could resolve the complete structure of the native b6-f complex from Adiantum

    • Would reveal species-specific structural adaptations

  • Genome editing in fern systems

    • Development of CRISPR-Cas9 protocols for ferns

    • Would enable direct functional studies through targeted mutations

  • Single-molecule techniques

    • Could measure electron transfer kinetics in individual complexes

    • Would reveal heterogeneity in function not apparent in bulk studies

  • Optogenetic control

    • Light-activated regulation of cytochrome activity

    • Would leverage Adiantum's natural photosensitivity

  • Advanced reconstitution systems

    • Nanodiscs and other membrane mimetics

    • Would provide more native-like environment than traditional liposomes

These approaches could build on established methodologies used for studying cytochrome proteins, such as the reconstituted systems demonstrated effective for cytochrome P450 enzymes .

How might research on Adiantum cytochrome b6 contribute to understanding plant adaptation to changing environments?

Adiantum capillus-veneris shows remarkable adaptability to various light conditions, with sophisticated photoreceptor systems including cryptochromes (CRY3, CRY4, CRY5) and phytochromes (Acphy1, Acphy2) . Understanding how cytochrome b6 function adjusts to these signals could reveal:

  • Mechanisms of photosynthetic acclimation to fluctuating light

  • Evolutionary adaptations in electron transport efficiency

  • Regulatory networks connecting light sensing to energy production

  • Potential applications for improving crop photosynthetic efficiency

The study of photochromic relocation in Adiantum demonstrates sophisticated spatial regulation of photoreceptors, which may directly influence the distribution and activity of photosynthetic machinery including cytochrome b6-f complexes . This spatial organization may represent adaptations to maximize photosynthetic efficiency under varying light conditions.

What potential biotechnological applications might emerge from research on fern cytochrome systems?

Research on Adiantum cytochrome systems could lead to several applications:

  • Photosynthesis enhancement in crops

    • Engineering more efficient electron transport chains

    • Adapting fern-specific regulatory mechanisms

  • Bioremediation technologies

    • Utilizing Adiantum's known antimicrobial properties

    • Engineering enhanced detoxification capacities

  • Biopharmaceutical production

    • Leveraging Adiantum's diverse secondary metabolites

    • Using recombinant cytochrome systems for novel compound synthesis

  • Biosensors for environmental monitoring

    • Developing light-responsive biosensors based on Adiantum photoreceptors

    • Creating electron-transfer based detection systems

  • Artificial photosynthesis

    • Mimicking the efficient light-harvesting capabilities of ferns

    • Developing biomimetic electron transport systems

The antimicrobial properties demonstrated by Adiantum capillus-veneris extracts, with minimum inhibitory concentrations as low as 0.48 μg/ml against Escherichia coli, suggest potential applications in developing new antimicrobial compounds .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.