Recombinant Adiantum capillus-veneris NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Adiantum capillus-veneris (Maidenhair fern)
Target Names
ndhC
Target Protein Sequence
MFLSHQYDSFWIFLLVCISIPLLAFSITRFAAPPREGPEKSTSYESGIEPKGDTWIRFQI RYYMFALVFTVFDVETVFLYPWATSFEELGLFAFVEVIVFIFILIVGLVYAWRKGALEWC
Uniprot No.

Target Background

Function

NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is believed to be the immediate electron acceptor. NDH couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient.

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Adiantum capillus-veneris NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)?

Adiantum capillus-veneris NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) is one of the eleven subunits (ndhA-K) encoded by the chloroplast genome that comprises the chloroplast NAD(P)H dehydrogenase complex. This complex functions as a homologue of mitochondrial complex I in the electron transport chain. The ndhC protein plays a crucial role in the proper assembly and function of this multi-subunit complex in the chloroplast thylakoid membrane . The protein is specifically derived from Adiantum capillus-veneris L. (commonly known as maidenhair fern), which has been the subject of extensive genomic research due to its status as a model homosporous fern species .

How is the ndhC gene organized in the chloroplast genome of Adiantum capillus-veneris?

In the chloroplast genome of Adiantum capillus-veneris, the ndhC gene exhibits a distinctive organizational structure characterized by partial overlap with another gene, ndhK. This overlapping arrangement is not unique to maidenhair fern but is conserved across many land plants . The genome of A. capillus-veneris comprises 30 chromosomes with a total assembled size of approximately 4.83 Gb, covering 97.58% of the estimated genome size . Within this genomic context, the chloroplast-encoded genes like ndhC represent a small but vital component. The ndhC gene in A. capillus-veneris is cotranscribed with ndhK, resulting in a polycistronic mRNA that undergoes a specialized translation mechanism .

What translation mechanisms govern ndhC expression in chloroplasts?

Translation of ndhC in chloroplasts involves sophisticated regulatory mechanisms due to its overlapping gene structure with ndhK. Research using in vitro translation systems from tobacco chloroplasts has revealed that the major initiation site of the downstream ndhK mRNA is the third AUG codon, located just 4 nucleotides upstream from the ndhC stop codon (UAG) . This close proximity creates a translational coupling system where the translation of ndhK depends on the termination of ndhC translation. Experimental evidence indicates that mutation of the ndhC stop codon arrests translation of the ndhK cistron, and frameshift mutations in ndhC coding regions similarly inhibit translation of the distal cistron . This intricate mechanism ensures coordinated expression of these functionally related proteins.

How does termination codon-dependent translation function in the ndhC/ndhK gene pair?

The termination codon-dependent translation in the ndhC/ndhK gene pair represents a sophisticated mechanism for regulating gene expression in overlapping cistrons. Studies using chloroplast in vitro translation systems have demonstrated that the translation of ndhK is directly dependent on the presence and proper positioning of the ndhC stop codon . When researchers experimentally removed the ndhC stop codon, translation of the ndhK cistron was abolished, indicating that ribosomes must recognize and interact with the termination signal of the upstream cistron before initiating translation of the downstream gene.

Interestingly, even when the 5'-UTR and AUG start codon of ndhC were removed, substantial translation of ndhK was still observed, but this translation was again eliminated when the ndhC stop codon was removed . This indicates that the termination codon plays a pivotal role beyond simply ending translation of the upstream cistron—it actively facilitates ribosomal reinitiation at the downstream cistron. This mechanism differs from conventional translational coupling models and represents an adaptation to ensure proper stoichiometric expression of these functionally related proteins.

What is the stoichiometric relationship between NdhC and NdhK proteins, and how is it maintained?

Research has revealed that the ndhC/ndhK mRNA produces NdhK and NdhC in similar amounts, contrary to expectations for overlapping cistrons where the downstream gene product is usually produced at lower levels . This balanced expression is achieved through a combination of translational coupling and termination codon-dependent pathways. Experimental evidence indicates that translation efficiency of the downstream ndhK cistron is similar to, or slightly higher than, that of the upstream ndhC cistron, which cannot be explained by current models of translational coupling alone . This suggests that additional mechanisms may be involved in fine-tuning the translation rates of these proteins to maintain their stoichiometric balance.

How do genomic features of Adiantum capillus-veneris influence ndhC expression?

The genomic features of Adiantum capillus-veneris significantly influence ndhC expression through various mechanisms related to genome organization and structure. The A. capillus-veneris genome is highly repetitive, with approximately 85.25% (4.11 Gb) consisting of repetitive sequences . This repetitive nature affects gene expression patterns, including those of chloroplast-encoded genes like ndhC.

A distinctive feature of the A. capillus-veneris genome is the expanded intron size, with a mean intron length of 4,844 bp. Approximately 88.98% of introns contain repeat elements, with LTR-RTs accounting for 52.47% of intron content . Although chloroplast genes typically lack introns, these genomic features may influence nuclear-encoded factors that regulate chloroplast gene expression, including translation efficiency of ndhC and related genes.

The genome also shows evidence of an ancient whole-genome duplication (WGD) event shared by all core leptosporangiate species, but no recent WGD events . This evolutionary history has shaped the genomic context in which ndhC functions, potentially influencing its regulatory mechanisms and interactions with other cellular components.

What experimental systems are optimal for studying ndhC translation mechanisms?

For studying ndhC translation mechanisms, in vitro translation systems derived from chloroplasts have proven particularly effective. Research demonstrates that tobacco chloroplast in vitro translation systems provide a powerful experimental platform for investigating the complex translation mechanisms of overlapping cistrons like ndhC/ndhK . These systems allow researchers to:

  • Identify authentic translation initiation sites through mutational analysis

  • Test the effects of stop codon modifications on translational coupling

  • Examine the consequences of frameshift mutations on downstream cistron translation

  • Quantify protein expression levels to determine stoichiometric relationships

A comprehensive experimental approach typically involves:

Experimental ApproachApplicationKey Advantages
In vitro translation systemTranslation mechanism studiesControlled environment, direct measurement of translation products
Site-directed mutagenesisFunctional analysis of specific sequence elementsPrecisely determines the role of individual nucleotides
Frameshift mutationsAnalysis of reading frame importanceTests translational coupling mechanisms
5'-UTR and start codon modificationsInvestigation of alternate initiation mechanismsReveals non-canonical translation pathways
Stop codon mutationsStudy of termination codon-dependent translationDemonstrates the critical role of termination signals

For optimal results, researchers should combine these approaches with modern techniques such as ribosome profiling and cryo-electron microscopy to gain deeper insights into the structural basis of these translation mechanisms.

How can researchers effectively isolate and characterize recombinant ndhC protein?

Isolation and characterization of recombinant ndhC protein presents several technical challenges due to its hydrophobic nature and involvement in a multi-subunit membrane complex. Based on current research methodologies, an effective approach includes:

  • Expression system selection: Heterologous expression in E. coli often results in inclusion bodies due to the hydrophobic nature of ndhC. Alternative systems include chloroplast transformation in model plants or cell-free expression systems that can better accommodate membrane proteins.

  • Purification strategy: A multi-step purification protocol typically involves:

    • Membrane solubilization using mild detergents such as n-dodecyl-β-D-maltoside

    • Affinity chromatography utilizing engineered tags (His-tag, Strep-tag)

    • Size exclusion chromatography to separate individual subunits or intact complexes

    • Ion exchange chromatography for further purification

  • Characterization methods: For comprehensive characterization of ndhC, researchers should employ:

    • SDS-PAGE and western blotting for purity assessment and antibody-based detection

    • Mass spectrometry for protein identification and post-translational modification analysis

    • Circular dichroism for secondary structure determination

    • Functional assays measuring NAD(P)H oxidation activity

When working specifically with Adiantum capillus-veneris ndhC, researchers must consider the genomic context of this organism. The chromosome-level genome assembly of A. capillus-veneris provides valuable resources for designing expression constructs and understanding regulatory elements .

What approaches can be used to study the interaction between ndhC and other subunits of the NAD(P)H dehydrogenase complex?

Studying protein-protein interactions within the NAD(P)H dehydrogenase complex requires specialized approaches that accommodate membrane proteins while preserving native interactions. Effective methodologies include:

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry analysis can identify interaction interfaces between ndhC and other subunits. This approach is particularly valuable for capturing transient or weak interactions within the complex.

  • Co-immunoprecipitation (Co-IP): Using antibodies against ndhC or epitope-tagged versions of the protein, researchers can pull down interaction partners and identify them through mass spectrometry or western blotting. When working with recombinant proteins, this can be adapted to pull-down assays using affinity tags.

  • Structural biology approaches:

    • Cryo-electron microscopy has proven valuable for resolving structures of large membrane protein complexes

    • X-ray crystallography, while challenging for membrane proteins, can provide high-resolution structural information when successful

    • Nuclear magnetic resonance (NMR) spectroscopy can provide valuable information about protein dynamics and interactions for smaller protein fragments

  • Functional complementation studies: By introducing mutations in ndhC and assessing their effects on complex assembly and function, researchers can infer important interaction regions. This can be complemented with:

Mutation TypeInformation ProvidedTechnical Approach
Alanine scanningIdentifies critical residues for function or interactionSite-directed mutagenesis followed by functional assays
Deletion constructsMaps interaction domainsTruncated protein expression and interaction testing
Chimeric proteinsDetermines specificity-determining regionsDomain swapping between homologous proteins
Point mutationsTests specific hypotheses about interaction mechanismsTargeted amino acid substitutions based on structural predictions

When studying Adiantum capillus-veneris specifically, researchers should leverage the available genome sequence data to identify all potential interacting partners and regulatory elements that might influence complex assembly .

How does the study of ndhC contribute to our understanding of chloroplast genome evolution?

The study of ndhC in Adiantum capillus-veneris provides valuable insights into chloroplast genome evolution, particularly regarding gene arrangement and expression regulation. The overlapping gene structure of ndhC and ndhK, which is conserved across many land plants, represents an evolutionary adaptation that maximizes genomic information storage while ensuring coordinated expression of functionally related proteins . This arrangement suggests selective pressure to maintain these genes in close proximity, possibly reflecting their interdependent functions in the NAD(P)H dehydrogenase complex.

Adiantum capillus-veneris, as a homosporous fern, occupies an important evolutionary position between bryophytes and seed plants. The chromosome-level genome assembly of A. capillus-veneris has revealed that its genome comprises 30 chromosomes with a size of approximately 4.83 Gb . This large genome size, primarily due to the expansion of repetitive elements which account for 85.25% of the genome, provides context for understanding how chloroplast genes like ndhC have evolved within different genomic backgrounds.

Evolutionary analysis of A. capillus-veneris has identified an ancient whole-genome duplication event shared by all core leptosporangiate species, but no evidence of recent whole-genome duplication events . This evolutionary history influences the genomic context in which chloroplast genes function and may have shaped the regulatory mechanisms governing ndhC expression.

What potential applications exist for engineering ndhC in photosynthesis research?

Engineering ndhC holds significant potential for advancing photosynthesis research and potentially improving plant performance under various environmental conditions. The NAD(P)H dehydrogenase complex, of which ndhC is a crucial component, plays important roles in cyclic electron flow around photosystem I, chlororespiration, and stress responses in plants. Manipulation of ndhC and its expression could therefore provide valuable tools for:

  • Enhancing photosynthetic efficiency under fluctuating light conditions by optimizing cyclic electron flow

  • Improving plant tolerance to environmental stresses such as drought, high light, and temperature fluctuations

  • Investigating fundamental questions about electron transport chain regulation and energy balance in chloroplasts

  • Developing bioenergetic models that better predict plant responses to changing environmental conditions

Specifically, the unique translational coupling mechanism between ndhC and ndhK presents an opportunity to engineer coordinated expression of multiple proteins in chloroplasts . By manipulating the overlapping region and termination codon-dependent translation, researchers could potentially develop new tools for chloroplast genetic engineering with precisely controlled stoichiometry of multiple gene products.

How can insights from ndhC research in Adiantum capillus-veneris be applied to crop improvement?

Research on ndhC in Adiantum capillus-veneris provides valuable insights that could be translated to crop improvement strategies, particularly in enhancing stress tolerance and photosynthetic efficiency. The maidenhair fern (A. capillus-veneris) has adapted to diverse ecological niches, suggesting that its photosynthetic machinery, including the NAD(P)H dehydrogenase complex, possesses unique functional characteristics that could be beneficial in crop plants.

Studies on A. capillus-veneris have shown that the plant contains bioactive compounds with anti-inflammatory and hypoglycemic properties . While these activities are not directly related to ndhC function, they demonstrate the potential value of studying non-model organisms like ferns for discovering novel biological activities and mechanisms that might be transferable to crop species.

The termination codon-dependent translation mechanism identified in ndhC/ndhK could be applied to agricultural biotechnology as a tool for coordinated expression of multiple transgenes . This could facilitate the introduction of complete metabolic pathways or multi-subunit protein complexes into crop plants with precisely controlled stoichiometry, potentially enabling more sophisticated engineering of photosynthesis and stress response pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.