Recombinant Adiantum capillus-veneris NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

Shipped with Ice Packs
In Stock

Description

Introduction to the Compound

The recombinant NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE) from Adiantum capillus-veneris is a key component of the chloroplast NADH dehydrogenase-like (NDH) complex. This enzyme plays a critical role in cyclic electron transport (CET) in photosynthesis, contributing to photoprotection and ATP synthesis under stress conditions. The recombinant form is engineered with an N-terminal His-tag for purification and expressed in E. coli, enabling structural and functional studies of the NDH complex .

NDH Complex Architecture

The NDH complex in chloroplasts consists of:

  1. Membrane subcomplex: Plastid-encoded subunits (NdhA–NdhG).

  2. Lumenal subcomplex: Plant-specific subunits (e.g., NdhL–NdhO).

  3. Stroma-exposed subcomplexes: Includes nucleus-encoded subunits like ndhE .

The ndhE subunit likely participates in electron transfer from NAD(P)H to plastoquinone, mediated by FMN and iron-sulfur (Fe-S) centers . This activity is critical for CET, which balances ATP/NADPH ratios during photosynthesis under stress .

Research Findings

  1. Protein Localization:

    • The ndhE subunit is localized to the stroma-exposed region of the NDH complex, facilitating interactions with stromal proteins (e.g., thioredoxin) .

    • Proteomic studies in Arabidopsis thaliana suggest similar subplastidial partitioning of NDH components .

  2. Assembly Dynamics:

    • Subcomplex A (containing ndhE) assembles independently in the stroma, requiring chaperones like Cpn60β4 .

    • Misfolded NdhH impairs assembly intermediates (e.g., 500-kD and 400-kD complexes), highlighting ndhE’s role in structural stability .

Applications in Research and Development

The recombinant ndhE protein serves as a tool for studying:

  • Cyclic Electron Transport: Mechanisms of CET regulation under oxidative stress or high light .

  • Protein-Protein Interactions: Binding assays with thioredoxin or other redox regulators .

  • Structural Biology: Cryo-EM or X-ray crystallography to resolve NDH subunit arrangements .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, should you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Kindly consult your local distributors for precise delivery time.
Note: Our proteins are standardly shipped with normal blue ice packs. If dry ice shipment is preferred, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. For optimal long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Adiantum capillus-veneris (Maidenhair fern)
Target Names
ndhE
Target Protein Sequence
MFEQGLILSAYLLCVGFFGLITSRNMVRALMSLELIFNAITLNFITLSNLFDNRETGEIF TLFVIAVAAAEAATGLAIALSIHRNRRSTRIDQSNLLKW
Uniprot No.

Target Background

Function
NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be plastoquinone. It couples the redox reaction to proton translocation, thereby conserving redox energy in a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of ndhE in Adiantum capillus-veneris?

The ndhE gene encodes a chloroplastic NAD(P)H-quinone oxidoreductase subunit that functions within the electron transport chain. Based on genomic studies of Adiantum capillus-veneris, this gene would be part of the 31,244 nuclear-encoded genes identified in the chromosome-level genome assembly . Unlike many other genes in this fern, the ndhE gene has likely been conserved through evolution without experiencing recent whole genome duplication events, as research indicates A. capillus-veneris only experienced ancient WGD on the branch leading to core leptosporangiate ferns .

How does the genome size of Adiantum capillus-veneris affect strategies for ndhE isolation?

The Adiantum capillus-veneris genome is approximately 4.8 Gb, which is 6.4 times larger than Azolla filiculoides (0.75 Gb) and 19.2 times larger than Salvinia cucullata (0.26 Gb) . This large genome size, primarily resulting from the expansion of repeat elements rather than whole genome duplication, necessitates specialized strategies for gene isolation. Researchers should consider employing transcriptome-guided approaches rather than whole-genome scanning, particularly utilizing tissue-specific transcriptome data from different developmental stages as demonstrated in previous studies .

What expression systems are optimal for recombinant production of Adiantum capillus-veneris proteins?

For recombinant expression of chloroplastic proteins from Adiantum capillus-veneris, researchers should consider systems that accommodate plant-specific post-translational modifications. Based on successful in vitro cultivation methods for Adiantum capillus-veneris, modified Murashige and Skoog (MS) media systems have been effective for plant tissue culture . For heterologous expression, E. coli BL21(DE3) systems with plant-optimized codons have shown efficacy for chloroplastic proteins. Alternative systems include plant-based transient expression in Nicotiana benthamiana or stable transformation in established plant expression platforms.

How can I optimize tissue culture conditions for obtaining Adiantum capillus-veneris material for ndhE studies?

Based on established protocols for Adiantum capillus-veneris, optimized tissue culture conditions include:

Culture PhaseMedia CompositionGrowth RegulatorsConditions
InitiationMS medium0-1.0 mg/L BA16h photoperiod, 25±2°C
ProliferationMS medium2.0 mg/L BA16h photoperiod, 25±2°C
Callus InductionMS medium0.5 mg/L 2,4-D + 0.5-1.0 mg/L BA16h photoperiod, 25±2°C

For protein expression studies specifically, juvenile pinnae typically show different expression patterns compared to mature tissues, so selecting the appropriate developmental stage is crucial . Researchers should collect tissues at various developmental stages, including juvenile, green, and mature sporangiums, to capture stage-specific expression patterns .

What RNA extraction methods are most effective for gene expression studies of ndhE in Adiantum capillus-veneris?

For RNA extraction from Adiantum capillus-veneris tissues, a combination approach yields optimal results:

  • Initial extraction using Plant RNA Extraction Reagent (Invitrogen)

  • Purification with RNeasy Mini kit (Qiagen)

  • Conversion to cDNA by reverse transcription (e.g., using FastQuant RT Kit)

  • Verification of RNA quality using Agilent 2100 Bioanalyzer (RIN value >8.0)

This method has been successfully employed in transcriptomic studies of Adiantum capillus-veneris, yielding high-quality RNA for downstream applications including qRT-PCR and RNA-Seq .

What cloning strategies are recommended for isolating the ndhE gene from Adiantum capillus-veneris?

Based on successful approaches with other genes from Adiantum capillus-veneris, the following cloning strategy is recommended:

  • Design primers based on the transcriptome sequence data available for Adiantum capillus-veneris

  • Perform RT-PCR using cDNA synthesized from RNA extracted from chloroplast-rich tissues

  • Clone the amplified fragment into an appropriate vector (e.g., pET28a for subsequent protein expression)

  • Verify the sequence through Sanger sequencing

Researchers have successfully used this approach to clone genes such as AcLBD16, AcAGL, AcBBM, AcWUS, and AcRKD from Adiantum capillus-veneris, as demonstrated in previous studies .

How can I analyze the evolutionary conservation of ndhE across fern species?

To analyze evolutionary conservation of ndhE:

  • Extract homologous sequences from available fern genomes and transcriptomes

  • Perform multiple sequence alignment using MUSCLE or MAFFT

  • Construct phylogenetic trees using maximum likelihood methods (RAxML or IQ-TREE)

  • Calculate synonymous (Ks) and non-synonymous (Ka) substitution rates

  • Conduct selection pressure analysis using PAML

This approach would be similar to the evolutionary analyses performed for other genes in Adiantum capillus-veneris, where researchers identified rapid diversification of certain gene families with the emergence of embryophytes . For ndhE specifically, comparing its conservation pattern with other chloroplast genes can provide insights into its evolutionary importance in fern photosynthesis.

What protocols are effective for studying the protein-protein interactions of ndhE in the chloroplast electron transport chain?

To study protein-protein interactions of the ndhE protein:

  • Co-immunoprecipitation (Co-IP):

    • Express epitope-tagged recombinant ndhE

    • Isolate intact chloroplasts from transformed tissues

    • Solubilize membranes with mild detergents (e.g., 1% n-dodecyl β-D-maltoside)

    • Perform immunoprecipitation with anti-tag antibodies

    • Identify interacting partners through mass spectrometry

  • Bimolecular Fluorescence Complementation (BiFC):

    • Create fusion constructs of ndhE and putative interacting partners with split fluorescent protein fragments

    • Transform protoplasts from Adiantum capillus-veneris tissue culture

    • Visualize interactions through confocal microscopy

  • Yeast Two-Hybrid Analysis adapted for membrane proteins:

    • Create bait and prey constructs with appropriate membrane protein modifications

    • Screen against a cDNA library derived from Adiantum capillus-veneris chloroplast-rich tissues

These approaches would build upon established protocols for studying protein interactions in complex photosynthetic assemblies.

How does environmental stress affect ndhE expression and function in Adiantum capillus-veneris?

Based on studies examining stress responses in Adiantum capillus-veneris, researchers investigating ndhE should:

  • Establish controlled stress conditions (e.g., hypoxia, high light, drought, or temperature extremes)

  • Measure transcriptional changes using qRT-PCR with specific primers for ndhE

  • Evaluate protein abundance changes through western blotting

  • Assess changes in chloroplast electron transport rates using chlorophyll fluorescence measurements

  • Correlate findings with physiological parameters (e.g., photosynthetic efficiency, ROS production)

Previous research has demonstrated that Adiantum capillus-veneris responds to stressful conditions such as hypoxia with altered gene expression patterns and cellular adaptations . For ndhE specifically, researchers should monitor its expression alongside established stress marker genes and correlate any changes with alterations in photosynthetic performance.

What bioinformatic approaches are recommended for analyzing ndhE sequence and structure?

For comprehensive bioinformatic analysis of ndhE:

  • Sequence Analysis:

    • Use BLAST and HMMer to identify homologs across plant lineages

    • Perform multiple sequence alignment with MAFFT or Clustal Omega

    • Identify conserved domains and functional motifs using InterProScan

  • Structural Analysis:

    • Predict secondary structure using PSIPRED

    • Generate 3D structural models using AlphaFold2 or SWISS-MODEL

    • Validate models with MolProbity and PROCHECK

    • Analyze membrane topology using TMHMM and Phobius

  • Functional Prediction:

    • Identify potential cofactor binding sites using 3DLigandSite

    • Predict functional effects of amino acid variations using PROVEAN or SIFT

    • Map conservation scores onto structural models using ConSurf

These approaches would complement experimental data and provide insights into the functional domains critical for ndhE activity in the chloroplast electron transport chain.

How can I analyze tissue-specific expression patterns of ndhE in Adiantum capillus-veneris?

To analyze tissue-specific expression:

  • Collect diverse tissue samples across the Adiantum capillus-veneris life cycle, similar to the nineteen tissue samples used for comprehensive transcriptome analysis in previous studies

  • Extract RNA and perform qRT-PCR using ndhE-specific primers

  • Alternatively, conduct RNA-Seq analysis on different tissues

  • Normalize expression data using validated reference genes for Adiantum capillus-veneris

  • Visualize expression patterns across tissues and developmental stages

For spatial expression analysis, in situ hybridization can be performed using protocols adapted for fern tissues, particularly focusing on photosynthetic tissues where chloroplastic proteins are predominantly expressed.

What statistical approaches should be used when analyzing contradictory data on ndhE function?

When faced with contradictory data regarding ndhE function:

  • Meta-analysis approach:

    • Systematically collect all available data on ndhE function

    • Evaluate study quality using predetermined criteria

    • Convert results to compatible effect sizes

    • Apply random-effects models to account for between-study heterogeneity

    • Perform subgroup analyses to identify variables influencing outcomes

  • Bayesian analysis framework:

    • Incorporate prior knowledge about NAD(P)H dehydrogenase complexes

    • Update probability estimates as new data becomes available

    • Evaluate competing hypotheses through Bayes factors

  • Multivariate analysis:

    • Apply principal component analysis to identify patterns across multiple variables

    • Use hierarchical clustering to identify experimental conditions yielding similar results

    • Implement ANOVA with post-hoc tests to identify significant factors affecting experimental outcomes

These approaches help researchers reconcile seemingly contradictory results by identifying conditional factors that influence ndhE function or by highlighting methodological variables that affect experimental outcomes.

What strategies can overcome challenges in recombinant expression of Adiantum capillus-veneris ndhE protein?

When facing difficulties with recombinant expression:

  • Codon optimization:

    • Adapt the ndhE coding sequence to the codon usage bias of the expression host

    • Remove rare codons that might cause translational pausing

  • Expression conditions optimization:

    • Test multiple induction temperatures (15-30°C)

    • Vary inducer concentrations (e.g., 0.1-1.0 mM IPTG for bacterial systems)

    • Explore different media formulations

    • Consider auto-induction media for bacterial expression

  • Solubility enhancement:

    • Express as fusion with solubility tags (MBP, SUMO, Trx)

    • Co-express with molecular chaperones

    • Use specialized detergents for membrane protein extraction

  • Alternative expression systems:

    • Switch to cell-free expression systems

    • Consider chloroplast-based expression systems

    • Explore insect cell or mammalian cell expression for complex proteins

These approaches address common challenges in expressing plant chloroplastic proteins while maintaining their functional integrity.

How can I validate the functionality of recombinant ndhE protein?

To validate recombinant ndhE functionality:

  • Spectrophotometric enzyme assays:

    • Measure NAD(P)H oxidation rates spectrophotometrically

    • Monitor quinone reduction using appropriate electron acceptors

    • Compare kinetic parameters with native complex

  • Electron transport measurements:

    • Incorporate purified protein into artificial liposomes

    • Measure electron transport using fluorescent probes

    • Analyze proton translocation using pH-sensitive dyes

  • Complementation assays:

    • Transform ndhE-deficient mutants with the recombinant gene

    • Assess restoration of photosynthetic phenotypes

    • Measure chlorophyll fluorescence parameters

These validation methods ensure that the recombinant protein maintains its native electron transport capabilities and can functionally integrate into photosynthetic complexes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.