Recombinant Adiantum capillus-veneris Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Adiantum capillus-veneris (Maidenhair fern)
Target Names
ycf4
Target Protein Sequence
MNSRPTWIQVEFIRGSRTFVNLCWACILVCGATGFLLVGFSSCIGKDLIPILSSKQIAFI PQGLVMCFYGIAGLFLGLYLCCTVFWNVGSGYNYFDKREGISSIFRWGFPGKNRRIHIRL ILGDIEAVGLRSQEGLFPSRILYLKVRGRQSIPLTRIGENSTPEYMEEKAAELARFLRIS IEGF
Uniprot No.

Target Background

Function

Appears essential for the assembly of the photosystem I complex.

Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Ycf4 and what role does it play in photosynthetic organisms?

Ycf4 is a thylakoid membrane protein essential for the accumulation of photosystem I (PSI) in photosynthetic organisms. It functions as part of a large macromolecular complex (>1500 kD) that serves as a scaffold for PSI assembly. This protein is encoded by the chloroplast genome in eukaryotes and is highly conserved across photosynthetic organisms from cyanobacteria to higher plants .

The significance of Ycf4 varies among species - it is absolutely essential for PSI complex assembly in the green alga Chlamydomonas reinhardtii, while cyanobacterial mutants lacking Ycf4 can still assemble PSI, albeit at reduced levels . This evolutionary divergence suggests adaptation of assembly mechanisms across different photosynthetic lineages.

What is the structural organization of the Ycf4 complex?

The Ycf4 protein is approximately 22 kDa with two putative transmembrane domains that anchor it to the thylakoid membrane. Electron microscopy has revealed that the largest structures in purified Ycf4 preparations measure approximately 285 × 185 Å, representing various oligomeric states .

The complex contains not only Ycf4 but also an opsin-related protein called COP2 and several PSI subunits including PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF, as identified through mass spectrometry and immunoblotting analyses. This composition supports the role of Ycf4 as a scaffold for PSI assembly, particularly in the early stages involving PSI reaction center subunits .

How does the PSI assembly process involving Ycf4 function?

The assembly of PSI is a stepwise process where Ycf4 appears to play a critical role in the initial stages. According to the three-dimensional structure of the PSI complex, the assembly likely begins with the integration of two large reaction center subunits, PsaA and PsaB, followed by the subsequent incorporation of peripheral subunits .

Pulse-chase protein labeling experiments have shown that PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as a pigment-containing subcomplex. This finding indicates that Ycf4 provides a platform for the assembly of PSI components in a coordinated manner. Mutants deficient in one of the reaction center subunits fail to accumulate PSI complex, highlighting the critical nature of this initial assembly step .

What methodologies are most effective for purifying the Ycf4 complex for study?

A highly effective approach for purifying the Ycf4 complex is tandem affinity purification (TAP) tagging. This method involves:

  • Genetic fusion of a TAP tag (consisting of calmodulin binding peptide and Protein A domains separated by a tobacco etch virus protease cleavage site) to the C-terminal end of Ycf4

  • Transformation of the construct into the chloroplast genome of the study organism

  • Solubilization of thylakoid membranes using n-dodecyl-β-d-maltoside (DDM)

  • Two-step affinity chromatography:

    • First column: Binding to IgG agarose via the Protein A domain

    • Cleavage with TEV protease

    • Second column: Binding to calmodulin resin in the presence of calcium ions

    • Elution with EGTA

This technique allows isolation of the intact Ycf4 complex under native conditions, preserving its interactions with associated proteins .

How can researchers validate that a TAP-tagged Ycf4 retains normal function?

To ensure that TAP-tagging does not interfere with Ycf4 function, researchers should perform several validation experiments:

  • Immunoblot analysis to verify expression and stability of the tagged protein

  • Sucrose density gradient centrifugation to confirm that the tagged protein maintains incorporation into large complexes (similar to wild-type Ycf4)

  • Fluorescence induction kinetics of dark-adapted cells to assess PSI activity

  • Growth tests under photoautotrophic conditions (both medium and high light)

  • Examination of PSI complex assembly via immunoblotting for PSI subunits

In studies with C. reinhardtii, TAP-tagged Ycf4 maintained functionality despite decreasing to approximately 25% of wild-type levels, indicating that tagged Ycf4 can serve as a reliable tool for studying complex formation and interactions .

What approaches can reveal the temporal dynamics of Ycf4-mediated PSI assembly?

To study the temporal aspects of PSI assembly involving Ycf4, researchers can employ:

  • Pulse-chase protein labeling: Briefly exposing cells to radioactively labeled amino acids (pulse) followed by a chase with unlabeled amino acids, then isolating the Ycf4 complex at different time points

  • Time-course analysis of complex formation after conditional expression of PSI components

  • Synchronization of cells followed by isolation of Ycf4 complexes at defined time points

  • Analysis of assembly intermediates accumulating under various conditions

These approaches can reveal the sequence of events in PSI assembly, identifying transient interactions and rate-limiting steps. Research has shown that PSI polypeptides associated with the Ycf4 complex are newly synthesized, supporting the role of Ycf4 in early assembly stages .

What techniques provide the best structural insights into the Ycf4 complex?

For comprehensive structural characterization of the Ycf4 complex, researchers should consider a multi-method approach:

  • Electron microscopy and single particle analysis: These techniques have revealed the approximate dimensions of the complex (285 × 185 Å) and can identify different oligomeric states

  • Mass spectrometry (LC-MS/MS): Essential for identifying protein components within the complex and their stoichiometry

  • Crosslinking mass spectrometry: Provides information about spatial relationships between complex components

  • Cryo-electron microscopy: Offers potential for higher resolution structural information

  • Biochemical characterization through sucrose gradient ultracentrifugation and ion exchange chromatography: Effective for analyzing complex stability and composition

The combination of these approaches provides complementary information about structure, composition, and dynamics of the Ycf4 complex.

How do mutations in Ycf4 affect PSI assembly across different species?

The effects of Ycf4 mutations show species-specific patterns:

SpeciesEffect of Ycf4 MutationReference
C. reinhardtiiComplete loss of PSI accumulation
CyanobacteriaReduced but not eliminated PSI assembly

These differential effects suggest evolutionary adaptations in PSI assembly mechanisms. Researchers investigating Ycf4 in Adiantum capillus-veneris should consider these species-specific patterns when designing experiments and interpreting results.

Comparative analysis across species can reveal conserved functional domains and species-specific adaptations. Site-directed mutagenesis targeting specific regions of Ycf4 can identify critical residues for function, while complementation studies with Ycf4 from different species can determine functional conservation.

What is the relationship between Ycf4 and other PSI assembly factors?

Ycf4 operates within a network of assembly factors that collectively ensure proper PSI formation. Other known factors include:

  • Ycf3: Contains tetratrico-peptide repeats and is essential for PSI assembly, directly interacting with PsaA and PsaD

  • Ycf37/Pyg: Contains tetratrico-peptide repeats and is essential for PSI assembly in Arabidopsis thaliana but plays a regulatory role in cyanobacteria

  • COP2: Closely associated with Ycf4 but not essential for PSI assembly; reduction to 10% of wild-type levels increases salt sensitivity of the Ycf4 complex but does not affect PSI accumulation

Understanding these interactions is critical for developing a comprehensive model of PSI assembly. Researchers should consider investigating potential synergistic or redundant functions among these factors when studying Ycf4 in Adiantum capillus-veneris.

What expression systems are most suitable for recombinant Ycf4 production?

The choice of expression system for recombinant Ycf4 depends on research objectives:

Expression SystemAdvantagesChallengesBest Applications
E. coliHigh yield, simple cultivationPotential misfolding of membrane proteinsBasic biochemical studies
CyanobacteriaNative-like environmentLower yield than E. coliFunctional studies
C. reinhardtiiEukaryotic chloroplast environmentComplex transformationAssembly studies
Plant chloroplastsHigher plant contextTechnical complexityEvolutionary studies

For Adiantum capillus-veneris Ycf4, researchers should consider both the research question and the technical capabilities of their laboratory when selecting an expression system.

What optimization strategies improve recombinant Ycf4 expression and functionality?

To optimize recombinant Ycf4 expression and functionality:

  • Codon optimization for the host organism

  • Addition of solubility tags (while verifying they don't interfere with function)

  • Use of appropriate detergents for membrane protein solubilization (e.g., n-dodecyl-β-d-maltoside has been successful)

  • Temperature and induction optimization

  • Co-expression with interaction partners (e.g., COP2) to improve stability

  • Verification of proper membrane insertion and folding

The successful expression of functional Ycf4 requires careful consideration of its membrane protein nature and interaction requirements.

How does Adiantum capillus-veneris Ycf4 compare with Ycf4 from model organisms?

While specific data on Adiantum capillus-veneris Ycf4 is limited in the current literature, as a fern, it represents an evolutionary intermediate between algae and seed plants. Comparative analysis between A. capillus-veneris Ycf4 and that of model organisms would likely reveal:

  • Conservation of core functional domains necessary for PSI assembly

  • Potential adaptations reflecting the evolutionary position of ferns

  • Species-specific interaction patterns with PSI components

Sequence alignment, phylogenetic analysis, and functional complementation studies would be valuable approaches for such comparisons.

What unique research opportunities does Adiantum capillus-veneris Ycf4 present?

Studying Ycf4 in Adiantum capillus-veneris offers several unique research opportunities:

  • Evolutionary insights: Ferns represent an important evolutionary position between bryophytes and seed plants, potentially revealing transitional adaptations in photosynthetic apparatus assembly

  • Connection to medicinal properties: A. capillus-veneris has demonstrated therapeutic effects, including under stressful conditions like hypoxia . Understanding its photosynthetic machinery could provide context for these properties

  • Stress adaptation: Ferns are known for their resilience to various environmental stressors. Studying Ycf4 in this context might reveal adaptations that enhance photosystem stability

  • Bioprospecting potential: Unique features of A. capillus-veneris Ycf4 might inspire biotechnological applications or synthetic biology approaches

What are common challenges in Ycf4 research and how can they be addressed?

Researchers working with Ycf4 frequently encounter these challenges:

ChallengeSolution Strategies
Low yield during purificationOptimize detergent type/concentration; increase starting material; use overnight incubation with affinity resin
Verifying complex integrityCombine multiple analytical techniques (sucrose gradient, native PAGE, size exclusion chromatography)
Distinguishing direct vs. indirect effectsDesign careful controls; use complementation studies; perform time-resolved analyses
Species-specific differencesPerform comparative studies; account for evolutionary context when interpreting results
Membrane protein solubilityTest multiple detergents; consider nanodiscs or other membrane mimetics

Awareness of these challenges allows researchers to design more robust experimental approaches.

How can researchers distinguish between Ycf4's direct role in PSI assembly versus indirect effects?

To distinguish direct from indirect effects of Ycf4 on PSI assembly:

  • Perform in vitro reconstitution experiments with purified components

  • Use site-directed mutagenesis to create separation-of-function mutants

  • Conduct pull-down assays to identify direct interaction partners

  • Employ time-resolved analyses to establish the sequence of assembly events

  • Use crosslinking approaches to capture transient interactions

  • Design conditional expression systems to enable temporal control of Ycf4 expression

These approaches collectively can provide strong evidence for direct roles versus secondary effects.

How can Ycf4 research be integrated with transcriptomic and proteomic analyses?

Integration of Ycf4 research with -omics approaches can provide comprehensive understanding:

  • Transcriptomics: Analyze co-expression patterns of ycf4 with other photosynthesis-related genes under various conditions to identify regulatory networks

  • Proteomics:

    • Quantitative proteomics to track changes in Ycf4 complex composition under different conditions

    • Comparative proteomics between wild-type and Ycf4-deficient mutants to identify downstream effects

    • Phosphoproteomics to identify potential regulatory modifications

  • Metabolomics: Assess metabolic consequences of Ycf4 dysfunction or modification

  • Network analysis: Place Ycf4 in the context of cellular protein interaction networks to identify unexpected functional connections

These integrative approaches can reveal system-level functions and regulatory mechanisms beyond what can be observed through focused studies of Ycf4 alone.

What computational models are useful for predicting Ycf4 structure and interactions?

Computational approaches to study Ycf4 include:

  • Homology modeling: Using structures of related proteins to predict Ycf4 structure

  • Molecular dynamics simulations: Modeling Ycf4 behavior in membrane environments

  • Protein-protein docking: Predicting interaction interfaces with PSI components

  • Evolutionary coupling analysis: Identifying co-evolving residues that might be functionally linked

  • Machine learning approaches: Predicting functional regions based on sequence features

These computational methods can guide experimental design and help interpret experimental results, particularly when high-resolution structural data is limited.

What emerging technologies will advance Ycf4 research?

Several emerging technologies hold promise for Ycf4 research:

  • Cryo-electron tomography: For visualizing Ycf4 complexes in their native membrane context

  • Single-molecule tracking: To observe Ycf4 dynamics during PSI assembly in real-time

  • Genome editing tools: For precise modification of Ycf4 and interacting partners

  • Synthetic biology approaches: To engineer optimized PSI assembly systems

  • Advanced mass spectrometry techniques: For more sensitive detection of transient interactions

  • Microfluidics-based approaches: For high-throughput analysis of Ycf4 variants

These technologies will enable more detailed mechanistic understanding of Ycf4 function.

How might research on Adiantum capillus-veneris Ycf4 contribute to biotechnological applications?

Research on A. capillus-veneris Ycf4 could lead to several biotechnological applications:

  • Improved photosynthetic efficiency: Understanding PSI assembly mechanisms could inform strategies to enhance photosynthesis in crops

  • Stress-resistant photosynthetic systems: Insights from ferns might reveal adaptations that could be transferred to agricultural species

  • Bioactive compound production: Understanding the link between photosynthetic capacity and secondary metabolite production in A. capillus-veneris could enhance production of its medicinal compounds

  • Bioremediation applications: Efficient photosynthetic systems could be engineered for environmental applications

  • Synthetic biology platforms: Novel assembly factors could be incorporated into artificial photosynthetic systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.