Recombinant Adiantum capillus-veneris Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference when placing the order, and we will do our best to fulfill it.
Lead Time
Delivery time may vary based on your purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: Our proteins are routinely shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, but customers can adjust this as needed.
Shelf Life
The shelf life of our proteins is influenced by several factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms maintain stability for 6 months at -20°C/-80°C, while lyophilized forms are stable for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary to avoid repeated freeze-thaw cycles, which can degrade the protein.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Adiantum capillus-veneris (Maidenhair fern)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLISVHLMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRIGVSKSWGGWIITGDTSTDAGIWSYEGVAAAHIILSGLLFLAAIWHWVYWDL DLFRDDRTGKPSLDLPKIFGIHLFLSGVLCFSFGAFHVTGLFGPGIWISDPYGLTGKVEP VDPAWGAEGFDPFIPGGIASHHIAAGVLGILAGLFHLSVRPPQRLYKALRMGNVETVLSS SIAAVFFAAFVVSGTMWYGSAATPIELFGPTRYQWDQGYFQQEIERRIRLGEAENLSLSQ VWSKIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAVGWLGHALFKDREGRELFVRRMP TFFETFPVVLVDGEGVVRADVPFRRAESKYSVEQVGVTVDFFGGELDGASFSDPATVKKY ARRAQLGEIFEFDRATLKSDGVFRSSPRGWFTFGHTTFALIFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPSTKKQAV
Uniprot No.

Target Background

Function
CP47 (chlorophyll apoprotein) is a crucial component of the photosystem II (PSII) core complex. It binds chlorophyll and plays a vital role in catalyzing the primary light-driven photochemical processes of PSII. PSII is a light-powered water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from water, generating oxygen and a proton gradient, which is subsequently used for ATP production.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbB gene and what role does it play in the chloroplast genome of Adiantum capillus-veneris?

The psbB gene encodes the CP47 chlorophyll apoprotein, a core component of photosystem II (PSII). In Adiantum capillus-veneris, this gene is part of the complete chloroplast genome, which has been fully sequenced. The CP47 protein functions as an intrinsic chlorophyll-binding protein crucial for light harvesting and energy transfer within PSII. Within the chloroplast genome organization, psbB is located within a series of conserved coding regions, though Adiantum shows some unique genomic rearrangements compared to other plant species. The gene's position and context within the chloroplast genome reflect evolutionary adaptations specific to ferns within the photosynthetic apparatus .

What techniques are commonly used to express recombinant CP47 protein?

Expression SystemAdvantagesLimitationsYield Optimization
E. coliRapid growth, easy genetic manipulationMay form inclusion bodies, lacks chloroplast-specific machineryLow temperature induction (18°C), fusion tags (MBP, SUMO)
CyanobacteriaNative photosynthetic machinery, proper foldingSlower growth, more complex manipulationLight cycle optimization, specialized media formulation
Plant cell culturesNative post-translational modificationsLow yields, long cultivation timeElicitor treatment, optimized harvesting timing
Cell-free systemsAvoids toxicity issues, rapidHigher cost, limited scaleSupplementation with chlorophyll, template optimization

For recombinant CP47 production, cyanobacterial systems often provide the best balance of authentic protein structure and reasonable yields, as they possess the native photosynthetic machinery required for proper CP47 folding and integration into membranes. Site-directed mutagenesis approaches similar to those used in Synechocystis 6803 can be adapted for studying the Adiantum protein variant .

How do mutations in conserved charged residues of the CP47 protein affect oxygen evolution in photosystem II?

Mutations in specific conserved charged residues of CP47 significantly impact oxygen evolution in PSII. Research utilizing site-directed mutagenesis in Synechocystis 6803 has demonstrated that modifications to positions 384R and 385R are particularly impactful. The experimental data reveals that substitutions at these positions (such as R384G, R385G, and RR384385EE) result in altered oxygen evolution efficiency without drastically reducing the number of PSII reaction centers . Specifically:

  • Quantum yield measurements show reduced oxygen evolution efficiency

  • Total fluorescence yield indicates approximately 85-90% of PSII reaction centers remain intact

  • S-state parameters (α, β, γ, δ) remain relatively unchanged

  • S2 lifetime increases 2-3 fold compared to control specimens

These findings suggest these conserved charged residues play a critical role in maintaining the proper conformation of the oxygen-evolving complex rather than directly affecting reaction center assembly. Similar mutational studies on recombinant Adiantum CP47 would reveal whether these functional domains maintain their roles across evolutionary diverse species or if ferns have developed alternative structural solutions. Researchers should employ both steady-state oxygen evolution measurements and flash-induced oxygen evolution to comprehensively characterize mutant phenotypes .

What analytical methods best reveal the interaction between CP47 and the oxygen-evolving complex in recombinant systems?

Analytical MethodInformation ProvidedSample RequirementsResolution Level
Crosslinking coupled with MSDirect interaction sitesPurified componentsAmino acid level
Cryo-electron microscopy3D structural arrangementMembrane preparations2.5-3.5 Å
FTIR difference spectroscopyConformational changesOriented membranesBond-specific vibrations
Hydrogen-deuterium exchange MSSolvent accessibility changesPartially purified complexesPeptide segment level
EPR spectroscopyRedox-active cofactor statesFlash-frozen samplesMolecular electronic state

For recombinant Adiantum CP47, a multimodal approach combining crosslinking mass spectrometry with EPR spectroscopy provides the most comprehensive mapping of interaction interfaces. This approach reveals both the structural contact points and the functional influence on redox reactions. Analytical protocols should incorporate oxygen evolution measurements under controlled light conditions to correlate structural findings with functional outcomes. When studying mutations, researchers should focus on changes in S2 lifetime, as this parameter proved particularly sensitive to CP47 alterations in related systems .

How can researchers address the challenge of properly folding and assembling recombinant CP47 with its associated chlorophyll molecules?

Proper folding and assembly of recombinant CP47 with its chlorophyll molecules presents a significant challenge that requires a multifaceted approach:

  • Expression system selection: Photosynthetic organisms (cyanobacteria) provide the necessary machinery for chlorophyll biosynthesis and insertion.

  • Chlorophyll supplementation protocol:

    • Add 5-aminolevulinic acid (0.2-0.5 mM) as a precursor to expression media

    • Maintain cultures under low light conditions (10-30 μmol photons m⁻² s⁻¹)

    • Control expression temperature (22-25°C) to prevent aggregation

  • Membrane fraction isolation:

    • Gentle cell disruption (osmotic shock or French press at 1,000 psi)

    • Differential centrifugation to isolate thylakoid-enriched fractions

    • Detergent screening (n-dodecyl-β-D-maltoside at 1% typically yields best results)

  • Assembly verification metrics:

    • Absorption spectra (characteristic peaks at 435 and 675 nm)

    • Circular dichroism to assess secondary structure

    • Chlorophyll:protein ratio determination (target 14-16 chlorophyll molecules per CP47)

    • Fluorescence lifetime measurements to assess energy transfer capability

Successful assembly can be confirmed via functional reconstitution assays measuring electron transfer capacity in artificial membrane systems. The primary challenge remains achieving consistent chlorophyll incorporation while maintaining proper protein folding.

What are the best strategies for designing site-directed mutagenesis experiments to study conserved domains in Adiantum CP47?

Effective site-directed mutagenesis experiments for Adiantum CP47 require strategic planning based on evolutionary conservation analysis and functional domain identification:

  • Target selection process:

    • Perform multiple sequence alignment across diverse photosynthetic lineages

    • Identify residues with >90% conservation across species

    • Focus on charged residues (R, K, D, E) in predicted interaction domains

    • Prioritize regions 364E-440D known to interact with the 33 kDa extrinsic protein

  • Mutation type selection:

    • Conservative substitutions: maintain charge but alter size (R→K)

    • Charge reversal: completely change electrostatic properties (R→E)

    • Alanine scanning: neutralize side chain contributions

    • Double mutations to test compensatory effects

  • Recommended controls:

    • Wild-type Adiantum CP47

    • Previously characterized mutations from model organisms

    • Mutations outside conserved domains

  • Expression and analysis workflow:

StageMethodKey ParametersExpected Outcome
Gene synthesisCodon optimizationCAI > 0.8 for expression hostImproved expression
Vector constructionGibson assembly25-30 bp overlapsSeamless cloning
TransformationElectroporation1800-2500V, 5ms pulseHigh efficiency
Expression verificationWestern blotAnti-CP47 antibodiesProtein of expected size
Functional assessmentOxygen evolution0-3000 μmol photons m⁻² s⁻¹Altered kinetics in mutants

The mutations at positions 384R and 385R should be prioritized based on their established impact in Synechocystis, focusing on whether these residues maintain their critical function in the evolutionary distinct fern lineage .

How can researchers effectively isolate and purify recombinant CP47 protein while maintaining its functional integrity?

Isolating functional recombinant CP47 requires carefully optimized protocols that preserve both protein structure and associated chlorophyll molecules:

  • Cell lysis conditions:

    • Buffer composition: 50 mM HEPES (pH 7.5), 10 mM MgCl₂, 5 mM CaCl₂, 10% glycerol

    • Protease inhibitor cocktail (PMSF, leupeptin, pepstatin A)

    • Gentle disruption methods (glass beads or French press)

    • Temperature maintenance (4°C throughout processing)

  • Membrane isolation protocol:

    • Differential centrifugation: 10,000×g (15 min), 40,000×g (30 min)

    • Sucrose gradient ultracentrifugation (20-60% sucrose)

    • Density verification by chlorophyll absorbance measurements

  • Solubilization optimization:

DetergentConcentration RangeIncubation TimeTemperatureProtein:Detergent Ratio
n-dodecyl-β-D-maltoside0.5-1.0%30-60 min4°C1:10-1:20
n-octyl-β-D-glucoside1.0-2.0%45-90 min4°C1:15-1:30
digitonin0.5-1.5%60-120 min4°C1:5-1:15
  • Purification strategy:

    • Immobilized metal affinity chromatography (if His-tagged)

    • Ion exchange chromatography (DEAE or Q Sepharose)

    • Size exclusion chromatography as final polishing step

    • Functional verification at each purification stage

  • Storage conditions:

    • 20 mM HEPES (pH 7.5), 5 mM MgCl₂, 0.03% n-dodecyl-β-D-maltoside

    • 10% glycerol as cryoprotectant

    • Flash freezing in liquid nitrogen

    • Storage at -80°C for up to 6 months

Success is monitored through absorption spectra analysis, maintaining the characteristic chlorophyll peaks at 435 and 675 nm, and through functional assays measuring electron transfer capability.

How should researchers interpret contradictory data between in vitro and in vivo studies of recombinant CP47 function?

When facing contradictory results between in vitro and in vivo studies of recombinant CP47, researchers should systematically evaluate potential sources of discrepancy:

  • Primary causes of contradiction:

    • Absence of native lipid environment in vitro

    • Incomplete assembly of PSII super-complex

    • Altered redox potential in experimental buffers

    • Missing auxiliary proteins or cofactors

  • Reconciliation approach:

    • Create intermediate experimental systems (e.g., reconstituted proteoliposomes)

    • Systematically add missing components to identify critical factors

    • Employ pulse-amplitude modulation (PAM) fluorescence in both systems

    • Develop mathematical models to account for environmental differences

  • Decision framework for data interpretation:

Observation TypeIn Vitro ResultIn Vivo ResultProbable ExplanationValidation Method
Electron transfer rateSlowerNormalMissing integral proteinsReconstitution with purified components
Oxygen evolutionAbsentPresentDisrupted OEC structureMetal ion supplementation
Fluorescence quenchingReducedNormalAltered antenna couplingTime-resolved spectroscopy
Redox potentialShiftedNormalBuffer effectsTitration experiments with redox mediators
  • Resolution strategies:

    • Focus on relative effects rather than absolute values

    • Normalize data to internal controls

    • Develop correction factors based on known differences

    • Consider genetic complementation studies in CP47-deficient mutants

The anomalous S2 lifetime extension observed in CP47 mutants represents a common type of discrepancy that might differ between in vitro and in vivo systems . By systematically addressing these issues, researchers can develop a more complete understanding of structure-function relationships in CP47.

What statistical approaches best analyze the impact of mutations on CP47 function across multiple parameters?

Comprehensive statistical analysis of CP47 mutations requires multivariate approaches that integrate diverse functional parameters:

  • Recommended statistical framework:

    • Multiple Analysis of Variance (MANOVA) for related dependent variables

    • Principal Component Analysis (PCA) to identify key sources of variation

    • Hierarchical clustering to identify mutation patterns with similar effects

    • Partial Least Squares Regression (PLS-R) to correlate structural changes with functional outcomes

  • Data normalization protocol:

    • Express all measurements as relative to wild-type (% of control)

    • Z-score standardization for parameters with different scales

    • Log transformation for parameters spanning multiple orders of magnitude

    • Winsorization to handle outliers (typically at 95th percentile)

  • Minimum statistical power requirements:

    • Sample size: n ≥ 6 biological replicates

    • Technical replicates: minimum of 3 per biological replicate

    • Power analysis to detect 25% difference at α = 0.05 with β = 0.8

  • Multiparameter correlation analysis:

ParameterCorrelation with Oxygen EvolutionCorrelation with S2 LifetimeIndependence Test (p-value)
PSII center countModerate (r = 0.4-0.6)Weak (r = 0.2-0.3)Significant (p < 0.05)
Fluorescence yieldStrong (r = 0.7-0.9)Moderate (r = 0.5-0.7)Non-significant (p > 0.05)
S-state transitionsModerate (r = 0.5-0.7)Strong (r = 0.8-0.9)Non-significant (p > 0.05)
  • Effect size interpretation:

    • Cohen's d: Small (0.2-0.5), Medium (0.5-0.8), Large (>0.8)

    • Mutation impact classification based on multivariate distance from wild-type

When analyzing data from mutations like those at positions 384R and 385R, this framework allows researchers to differentiate between direct effects on oxygen evolution versus indirect effects through altered S2 state stability . This comprehensive approach provides mechanistic insights rather than merely cataloging phenotypic changes.

How might CRISPR-Cas9 techniques be adapted for studying psbB gene modifications in Adiantum capillus-veneris?

Implementing CRISPR-Cas9 for psbB modification in Adiantum capillus-veneris requires specialized approaches addressing the unique challenges of fern chloroplast genome editing:

  • Delivery system optimization:

    • Particle bombardment with gold microparticles (1.0 μm diameter)

    • Protoplast isolation using cell wall degrading enzymes (2% cellulase, 0.5% macerozyme)

    • PEG-mediated transformation (40% PEG 4000) for protoplasts

    • Agrobacterium-mediated transformation for gametophytes

  • Vector system design:

    • Chloroplast-specific promoters (psbA promoter from Adiantum)

    • Codon-optimized Cas9 for chloroplast expression

    • Incorporation of chloroplast-specific localization sequences

    • Selection markers visible in haploid gametophytes

  • Guide RNA targeting strategy:

Target RegionGuide RNA SequencePredicted EfficiencyOff-Target Potential
384-385 RR motif5'-NNNCRISPR20bpSequenceNGG-3'High (score > 0.7)Low (0-1 sites)
Chlorophyll binding sites5'-NNNCRISPR20bpSequenceNGG-3'Medium (score 0.5-0.7)Medium (2-3 sites)
Domain interfaces5'-NNNCRISPR20bpSequenceNGG-3'High (score > 0.7)Very low (0 sites)
  • Homology-directed repair template design:

    • 800-1000 bp homology arms

    • Silent mutations in PAM sites to prevent re-cutting

    • Incorporation of screening markers (point mutations creating restriction sites)

  • Verification workflow:

    • PCR screening with mutation-specific primers

    • Restriction fragment length polymorphism analysis

    • Whole chloroplast genome sequencing

    • Transcript analysis by RT-PCR

This approach would enable precise modification of the conserved regions identified in previous mutagenesis studies, particularly the critical 384R and 385R positions, facilitating comparative analysis between fern and cyanobacterial photosystems .

What are the most promising approaches for studying the evolutionary conservation of CP47 function across diverse plant lineages?

Investigating evolutionary conservation of CP47 requires integrative approaches spanning from sequence to function across diverse plant lineages:

  • Phylogenetic analysis framework:

    • Maximum likelihood reconstruction of psbB evolution

    • Ancestral sequence reconstruction at key evolutionary nodes

    • Molecular clock calibration using fossil evidence

    • Selection pressure analysis (dN/dS ratios) across functional domains

  • Comparative functional assessment:

    • Heterologous expression of CP47 variants from key lineages

    • Chimeric proteins combining domains from different evolutionary sources

    • In vitro reconstitution with standardized partner proteins

    • Oxygen evolution measurements under standardized conditions

  • Structure-function correlation across lineages:

LineageKey Structural AdaptationsFunctional ImpactEvolutionary Significance
Ferns (Adiantum)Altered domain interfacesModified OEC stabilityAdaptation to low light
CyanobacteriaMinimal core structureRapid turnoverAncestral form
GymnospermsEnhanced stability domainsStress toleranceAdaptation to varied environments
AngiospermsOptimized light-harvesting interfacesEfficiency increaseCompetitive advantage
  • Integrative data visualization:

    • Mapping functional parameters onto phylogenetic trees

    • Structural overlay with conservation heat-mapping

    • Correlation networks of co-evolving residues

    • Ancestral state reconstruction for functional parameters

This approach would reveal whether the critical domains identified in cyanobacteria, such as the 384R-385R region and the 364E-440D interaction domain, maintain their functional importance across evolutionary diverse lineages including Adiantum . The unique chloroplast genome structure of Adiantum, with its documented rearrangements, provides an excellent model for understanding how structural conservation maintains function despite genomic reorganization .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.