Recombinant Adiantum capillus-veneris Photosystem II D2 protein (psbD)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

The protein is expressed in Escherichia coli systems for research applications, with modifications to enhance stability and solubility :

  • Expression Vector: Utilizes N-terminal His-tag or undisclosed fusion tags for affinity chromatography .

  • Storage: Tris-based buffer with 50% glycerol; stable at -20°C to -80°C .

  • Purity: >85% (verified via SDS-PAGE) .

Table 2: Recombinant Production Parameters

ParameterSpecification
Host OrganismEscherichia coli
Tag TypeHis-tag or custom (determined post-production)
Buffer CompositionTris, 50% glycerol
Recommended Storage-80°C (long-term); 4°C (short-term aliquots)

Functional Role in Photosystem II Assembly

The D2 protein is essential for PSII biogenesis and function:

  • Reaction Center Assembly: Partners with D1 to stabilize cofactors like P680, pheophytin, and plastoquinone .

  • Cofactor Integration: Facilitates binding of non-heme iron and bicarbonate within the electron transport chain .

  • Repair Cycle: Degraded under photoinhibition and replaced via a coordinated synthesis-assembly process involving auxiliary proteins (e.g., Slr0575, CyanoP) .

Key Insights from Studies:

  • Assembly Intermediates: D2 integrates into early RCII* complexes alongside Hlips (High-light-inducible proteins) and Ycf48, forming a pre-complex before CP47/CP43 binding .

  • Light Regulation: Translation of psbD mRNA in chloroplasts is redox-regulated, with disulfide bridge dynamics influencing ribosomal binding .

  • Biotechnological Utility: Recombinant psbD enables structural studies (e.g., cryo-EM) and herbicide resistance screening targeting PSII .

Current Challenges:

  • Instability: Unassembled D2 is prone to proteolysis, necessitating chaperones like Slr0575 for stabilization .

  • Heterogeneity: Post-translational modifications (e.g., phosphorylation) vary across species, complicating functional extrapolation .

Future Directions

Ongoing research aims to:

  1. Elucidate D2’s role in PSII super-complex conformational changes .

  2. Engineer thermostable variants for industrial bioenergy applications .

  3. Characterize cross-species functional conservation using recombinant models .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. For dry ice shipment, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we suggest briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard protocol includes a 50% glycerol final concentration, which can be used as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms offer a longer shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a particular tag type requirement, please inform us and we will prioritize its development.
Synonyms
psbD; Photosystem II D2 protein; PSII D2 protein; Photosystem Q(A protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Adiantum capillus-veneris (Maidenhair fern)
Target Names
psbD
Target Protein Sequence
MTIAIGKSSKEPKDLFDSMDDWLRRDRFVFVGWSGLLLFPTAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGS FALIGFMLRQFELARSVQLRPYNAVAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ SEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLVFPEEVLPRGNAL
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H(2)O, generating O(2) and a proton gradient. This gradient subsequently drives ATP formation. PSII comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts light energy into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors. D2 plays a crucial role in the assembly of a stable PSII complex.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbD gene in Adiantum capillus-veneris and what does it encode?

The psbD gene in Adiantum capillus-veneris encodes the D2 protein, which is a chlorophyll-binding protein located in the photosystem II reaction center. It plays a crucial role in photosynthetic electron transport and is essential for light energy conversion. In higher plants, including ferns like A. capillus-veneris, transcription of psbD involves multiple promoters, with at least one being regulated specifically by blue light . The protein is part of the core complex of photosystem II and works in coordination with other proteins to facilitate the primary photochemical reactions of photosynthesis.

How does light regulation of psbD differ in ferns compared to seed plants?

In ferns like Adiantum capillus-veneris, psbD regulation shows distinct characteristics compared to seed plants. While both utilize light-responsive elements in their promoters, A. capillus-veneris demonstrates unique photoreceptor systems. For instance, the fern utilizes Acphy2, a phytochrome that relocates to the nucleus in a red light-dependent manner, affecting gene expression including that of psbD . Unlike seed plants, ferns of Leptosporangiopsida (including A. capillus-veneris) appear to lack a blue light-specific stomatal response despite possessing functional phototropin and plasma membrane H+-ATPase . This suggests evolutionary divergence in light-sensing mechanisms that influence photosynthetic gene regulation between ferns and seed plants.

What experimental techniques are commonly used to study psbD expression in Adiantum capillus-veneris?

Research on psbD expression in A. capillus-veneris typically employs several key methodologies:

  • Microbeam irradiation techniques - Used to selectively irradiate specific cellular regions with different light wavelengths to study localized photoreceptor responses

  • Reporter gene assays - Utilizing PHY-GUS or CRY-GUS fusion proteins to track photoreceptor localization and activity

  • Gel-shift assays - To study protein-DNA interactions at the psbD promoter region and identify regulatory factors like AGF and PGTF complexes

  • Particle bombardment - For transient expression of recombinant proteins in spores to study subcellular localization

  • Mutant analysis - Studying phenotypes of photoreceptor mutants to determine specific roles in psbD regulation

How do protein-DNA interactions regulate psbD transcription in photosynthetic organisms?

Transcription of the psbD gene is regulated through specific protein-DNA interactions at its promoter region. The psbD blue-light-regulated promoter (BLRP) contains multiple protein binding sites that orchestrate its expression. Key interactions include:

  • AGF complex binding - This occurs immediately upstream of the -35 region and is required for in vitro transcription from the psbD BLRP

  • PGTF complex binding - This occurs between positions -71 and -100, upstream of the AGF binding site

  • ADP-dependent regulation - ADP-dependent phosphorylation selectively inhibits PGTF binding to the psbD BLRP, providing a mechanism for metabolic control of gene expression

These interactions form a sophisticated regulatory network where light signals and metabolic status converge to control psbD transcription. The inhibition of PGTF binding by ADP appears to be selective, as other nucleotides like UTP, GTP, and CTP have minimal effects on complex formation . This selectivity suggests a specific recognition mechanism that links energy status to transcriptional regulation.

What is the role of ADP-dependent phosphorylation in regulating psbD expression?

ADP-dependent phosphorylation represents a critical regulatory mechanism for psbD expression through its effects on transcription factor binding. Research has revealed that:

  • ADP at low concentrations (0.1 mM) inhibits PGTF binding to the psbD BLRP, whereas ATP requires higher concentrations (1-5 mM) for similar effects

  • The addition of phosphocreatine and phosphocreatine kinase (an ADP-scavenging system) prevents ATP from modifying PGTF binding, confirming ADP as the active molecule

  • The protein kinase inhibitor K252a blocks ADP's ability to modify PGTF binding, indicating that ADP-dependent protein phosphorylation is involved

  • This phosphorylation likely modifies threonine residues, similar to mechanisms observed in other chloroplast proteins like PPDK and the psbA RNA-binding complex

This ADP-dependent regulation provides a mechanism to link photosynthetic gene expression with cellular energy status, potentially optimizing photosystem component production based on metabolic demands.

How do different spectral qualities of light affect psbD regulation?

Different wavelengths of light trigger distinct regulatory pathways affecting psbD expression in A. capillus-veneris:

Light QualityPrimary PhotoreceptorEffect on psbDMolecular Mechanism
Red LightAcphy2 (phytochrome)InductionNuclear translocation of Acphy2 leading to altered gene expression
Far-Red LightAcphy2 (phytochrome)RepressionPhotoreversible prevention of red light induction
Blue LightCryptochromes (CRY3/4)RepressionPhoto-irreversible inhibition of red light-induced expression

The wavelength dependence demonstrates complex integration of multiple photoreceptor systems. Blue light has been shown to photo-irreversibly prevent red light-induced gene expression, suggesting antagonistic regulation between different photoreceptor pathways . This spectral specificity allows for fine-tuned responses to different light environments.

What are the challenges in expressing recombinant A. capillus-veneris psbD protein in heterologous systems?

Recombinant expression of the A. capillus-veneris psbD protein presents several significant challenges:

  • Membrane protein expression difficulties - As a chlorophyll-binding membrane protein, D2 requires specific lipid environments and cofactors for proper folding

  • Cofactor integration - Proper assembly requires coordinated incorporation of chlorophyll, pheophytin, and quinone molecules

  • Post-translational modifications - Light-dependent phosphorylation and other modifications may be essential for function but difficult to replicate in heterologous systems

  • Assembly with partner proteins - D2 functions as part of a multiprotein complex that requires coordinated expression of multiple components

Researchers addressing these challenges typically employ specialized expression systems such as chloroplast transformation in model organisms, membrane-mimetic environments for in vitro studies, or transient expression systems using particle bombardment approaches similar to those used in studying PHY-GUS fusion proteins .

How can researchers distinguish between transcriptional and post-transcriptional regulation of psbD?

Distinguishing between transcriptional and post-transcriptional regulation requires multiple complementary approaches:

  • Nuclear run-on assays - These detect nascent transcripts to measure actual transcription rates independent of transcript stability

  • Promoter-reporter constructs - Recombinant constructs containing the psbD promoter fused to reporter genes like GUS can isolate transcriptional regulation effects

  • mRNA stability assays - Measuring transcript half-life after transcription inhibition helps identify post-transcriptional mechanisms

  • Polysome profiling - This technique determines the translation status of mRNAs to identify translational regulation

  • Protein phosphorylation analysis - As demonstrated with PGTF binding to the psbD promoter, phosphorylation status can affect transcription factor activity and should be monitored using phospho-specific antibodies or mass spectrometry

Research shows that psbD regulation involves both levels: transcriptional control through photoreceptor-mediated signaling and post-transcriptional mechanisms including ADP-dependent phosphorylation affecting transcription factor binding .

What methodologies are effective for studying photoreceptor-mediated nuclear translocation affecting psbD expression?

Studying photoreceptor translocation in relationship to psbD expression requires sophisticated techniques:

  • Microbeam irradiation experiments - These allow precise spatial control of light stimuli to determine the subcellular localization of active photoreceptors. In A. capillus-veneris spore germination studies, this approach revealed that phytochrome gradually migrates to the nuclear region following red light irradiation

  • Fluorescent protein fusions - Creating GFP-tagged versions of photoreceptors allows real-time visualization of their movement in response to different light qualities

  • PHY-GUS fusion proteins - These have been successfully used to demonstrate that Acphy2, but not Acphy1, migrates into the nucleus in a red light-dependent manner in A. capillus-veneris

  • Subcellular fractionation - Isolating nuclear and cytoplasmic fractions after light treatments can quantify photoreceptor relocalization

  • Chromatin immunoprecipitation (ChIP) - This technique can determine if photoreceptors associate with the psbD promoter region directly or via intermediary factors

The migration of photoreceptors like Acphy2 into the nucleus in response to specific light wavelengths represents a key regulatory mechanism affecting psbD expression .

How do cryptochrome and phytochrome signaling pathways interact to regulate psbD in A. capillus-veneris?

The interaction between cryptochrome and phytochrome signaling pathways in regulating psbD expression in A. capillus-veneris represents a sophisticated regulatory network:

  • Antagonistic regulation - Blue light (perceived by cryptochromes) can photo-irreversibly prevent red light (perceived by phytochromes) induced gene expression, suggesting antagonistic cross-talk between these pathways

  • Nuclear co-localization - Both GUS-CRY3/4 and Acphy2 can localize to the nucleus, potentially enabling direct interaction or competition for regulatory factors

  • Differential light responsiveness - Expression analysis has revealed genes regulated by phytochrome that are antagonistically controlled by blue light receptors in A. capillus-veneris spores

This interaction likely enables integration of multiple light cues to optimize photosynthetic gene expression under varying environmental conditions. Cryptochromes CRY3, CRY4, or both may function as the photoreceptors mediating inhibition of spore germination by blue light, while Acphy2 promotes germination in response to red light .

What is the relationship between chloroplast positioning and psbD expression in fern cells?

Research on A. capillus-veneris has revealed intriguing connections between chloroplast positioning and photosynthetic gene regulation:

  • Light-dependent organelle movement - Chloroplasts in A. capillus-veneris respond to different light conditions by repositioning within the cell, a process involving actin filaments

  • Photoreceptor-mediated responses - Under weak light, circular actin structures form around stationary chloroplasts, while short actin filaments appear at the leading edge of moving chloroplasts during light-induced relocation

  • Red-light positioning - In neo1 mutants, chloroplasts still relocate from dark position to light position under red light, indicating a photosynthesis-dependent nondirectional movement mechanism

  • Metabolic connection - Nuclear light positioning can be induced in darkness with the addition of sucrose or glucose, suggesting integration of metabolic and light signaling

This relationship may represent a coordinated regulatory system where chloroplast positioning optimizes light capture while simultaneously affecting nuclear gene expression through retrograde signaling pathways that influence psbD transcription.

How can researchers distinguish between direct and indirect effects of photoreceptors on psbD expression?

Distinguishing direct versus indirect photoreceptor effects requires specific experimental approaches:

  • Chromatin immunoprecipitation (ChIP) - To determine if photoreceptors directly associate with the psbD promoter

  • Transcriptome analysis in photoreceptor mutants - Comparing expression profiles in wild-type versus mutant backgrounds helps identify direct versus indirect targets

  • Inducible expression systems - Using chemical-inducible photoreceptor expression can help separate direct from indirect effects by controlling timing

  • Protein-protein interaction studies - Techniques like co-immunoprecipitation or yeast two-hybrid assays can identify direct interaction partners

  • Photoreceptor domain analysis - Studies with truncated photoreceptors lacking specific domains can determine which regions are required for psbD regulation

Research has shown that Acphy2 appears to be the primary photoreceptor for fern spore germination, but distinguishing its direct effects on psbD from indirect signaling cascade effects requires these more sophisticated approaches .

What are the most effective systems for expressing and purifying recombinant A. capillus-veneris psbD protein?

For successful recombinant expression of A. capillus-veneris psbD protein, researchers should consider these approaches:

Expression SystemAdvantagesChallengesBest Applications
E. coli with membrane-targeting signalsHigh yield, economicalPotential misfolding, lacks chloroplast-specific modificationsInitial structural studies, antibody production
Chlamydomonas reinhardtii chloroplast transformationNative-like environment, proper cofactor assemblyLower yields, longer generation timeFunctional studies requiring assembled PSII
Tobacco transplastomic linesScalable, can incorporate cofactorsComplex transformation processLarge-scale production for biochemical studies
Cell-free expression systemsControlled environment, rapidExpensive, may require supplementation with lipids and cofactorsStructure-function relationship studies

Particle bombardment techniques, as used for PHY-GUS fusion proteins in A. capillus-veneris spores, can also be adapted for transient expression studies of recombinant psbD in its native cellular environment .

How can mutagenesis studies of recombinant psbD advance our understanding of light-regulated gene expression?

Strategic mutagenesis of recombinant psbD can provide valuable insights into light-regulated gene expression:

  • Promoter element mutations - Targeted modifications of binding sites for complexes like AGF and PGTF can elucidate their specific contributions to light responsiveness

  • Phosphorylation site mutations - Converting potential phosphorylation targets (particularly threonine residues) to non-phosphorylatable amino acids can determine the role of ADP-dependent phosphorylation

  • Domain swap experiments - Creating chimeric proteins between A. capillus-veneris psbD and homologs from other species can identify regions responsible for fern-specific regulation

  • Photoreceptor binding site modifications - Altering potential photoreceptor interaction regions can reveal direct regulatory mechanisms

The ADP-dependent phosphorylation that selectively inhibits PGTF binding to the psbD BLRP represents an excellent target for such mutagenesis approaches, as this mechanism appears to be specific and potentially conserved among photosynthetic organisms .

What computational approaches are valuable for predicting structural features of the A. capillus-veneris D2 protein?

Modern computational approaches offer powerful tools for studying the structural aspects of A. capillus-veneris D2 protein:

  • Homology modeling - Using the crystal structures of photosystem II from other organisms as templates to predict A. capillus-veneris D2 structure

  • Molecular dynamics simulations - These can provide insights into the dynamics of protein domains under different conditions, similar to MD simulations that have revealed conformational differences between crystal structures of isolated photoreceptor domains and their biologically active conformations

  • Protein-protein docking - Predicting interactions between D2 and other photosystem components or regulatory proteins

  • Quantum mechanical calculations - For modeling electron transfer reactions within the assembled photosystem

  • Sequence conservation analysis - Identifying evolutionarily conserved regions that may be functionally critical

Molecular dynamics simulations have already proven valuable in understanding photoreceptor dynamics and can be applied to study how light-induced conformational changes in proteins like Acphy2 might influence downstream targets including psbD .

What emerging technologies might advance the study of A. capillus-veneris psbD regulation?

Several cutting-edge technologies show promise for deepening our understanding of psbD regulation:

  • CRISPR-Cas9 genome editing - For creating precise mutations in the native psbD gene or its regulatory elements in A. capillus-veneris

  • Single-cell transcriptomics - To study cell-type specific regulation of psbD expression within different tissues

  • Live-cell super-resolution microscopy - For tracking photoreceptor movements and interactions in real-time with nanometer precision

  • Optogenetic tools - To artificially control photoreceptor activity with spatial and temporal precision

  • Cryo-electron microscopy - For high-resolution structural studies of the D2 protein within the assembled photosystem II complex

These approaches could overcome current limitations in understanding the precise mechanisms of light-dependent nuclear translocation of photoreceptors like Acphy2 that have been demonstrated to affect gene expression in A. capillus-veneris .

How might understanding psbD regulation in A. capillus-veneris inform strategies for improving photosynthetic efficiency?

Insights from A. capillus-veneris psbD regulation could inform several approaches to enhancing photosynthesis:

  • Optimized light harvesting - Understanding how ferns regulate photosystem components in response to different light qualities could inform engineering of crops with enhanced light utilization

  • Stress resilience - The complex regulatory networks involving ADP-dependent phosphorylation might reveal mechanisms for maintaining photosynthetic efficiency under energy-limiting conditions

  • Evolutionary adaptation mechanisms - Comparing psbD regulation between ferns and seed plants could identify convergent solutions to photosynthetic challenges

  • Circadian optimization - Insights into temporal regulation of photosynthetic genes could inform strategies for matching gene expression to diurnal patterns

The antagonistic regulation between red and blue light pathways observed in A. capillus-veneris spores represents a sophisticated integration system that could inspire biomimetic approaches to photosynthetic regulation in agricultural applications.

What are the key unresolved questions regarding the role of photoreceptors in psbD regulation?

Despite significant progress, several fundamental questions remain unresolved:

  • Direct versus indirect regulation - Do photoreceptors like Acphy2 directly interact with the psbD promoter or operate through intermediate signaling components?

  • Phosphorylation targets - What are the specific proteins and residues that undergo ADP-dependent phosphorylation to regulate psbD expression?

  • Evolutionary conservation - How conserved are these regulatory mechanisms across different fern species and other plant lineages?

  • Integration with metabolism - How precisely do cells integrate light signals with metabolic status to optimize psbD expression?

  • Temporal dynamics - What are the kinetics of photoreceptor relocalization and subsequent changes in gene expression?

Addressing these questions will require integrative approaches combining genetic, biochemical, and advanced imaging techniques. The identification of ADP rather than ATP as the key molecule affecting PGTF binding suggests unique regulatory mechanisms that may have evolved specifically in photosynthetic organisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.