Recombinant Adiantum capillus-veneris Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, kindly include it in your order notes, and we will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend contacting your local distributor for specific delivery timeframe.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as an additional charge will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize development of the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Adiantum capillus-veneris (Maidenhair fern)
Target Names
psbA
Target Protein Sequence
MTATLERRESASLWGRFCDWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFVAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAAAAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex responsible for capturing photons, and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbA gene and what role does it play in Adiantum capillus-veneris?

The psbA gene encodes the D1 protein, a critical component of the core complex of Photosystem II (PS II). This photosynthetic oxygen-evolving system is responsible for producing almost the entire oxygen in the atmosphere. In Adiantum capillus-veneris, as in other ferns, the psbA gene plays a crucial role in the plant's photosynthetic machinery, enabling the conversion of light energy into chemical energy through electron transport chains .

How does psbA in Adiantum capillus-veneris differ from psbA in other plant species?

The psbA gene in Adiantum capillus-veneris and other ferns has undergone unique evolutionary processes compared to other plant lineages. Particularly in leptosporangiate ferns, psbA underwent gene duplication, and interestingly, both copies have been preserved since this duplication event. This preservation suggests functional or regulatory specialization between the copies, which is unusual since gene duplication typically leads to non-functionalization of one copy. The evolutionary dynamics of psbA in ferns reflect adaptations to their specific ecological niches .

What cellular structures in Adiantum capillus-veneris are associated with photosynthetic functions?

Although protonemal cells of Adiantum capillus-veneris typically do not form a phragmosome (PS), research has shown that a PS-like structure can develop at the site of a preprophase band (PPB) of microtubules when the nucleus and endoplasm are displaced through centrifugation. This PS-like structure contains endoplasmic microtubules, F-actin, oil droplets, and mitochondria, which are important for cellular function. The development of this structure is associated with both PPB formation and the cell cycle stage, suggesting complex regulatory mechanisms for cellular organization in relation to photosynthetic functions .

What are the recommended techniques for isolating recombinant psbA protein from Adiantum capillus-veneris?

For effective isolation of recombinant psbA protein from Adiantum capillus-veneris, researchers should employ a multi-step approach. First, fresh frond tissue should be flash-frozen in liquid nitrogen and ground to a fine powder. Protein extraction requires a buffer containing detergents suitable for membrane proteins (such as n-dodecyl β-D-maltoside), protease inhibitors, and reducing agents. For recombinant expression, the psbA gene sequence should be optimized for the expression system (bacterial, yeast, or insect cell) with appropriate tags for purification. Affinity chromatography followed by size exclusion chromatography is recommended for obtaining high-purity protein. Throughout the process, samples should be protected from light and maintained at 4°C to prevent degradation of the photosensitive complex .

How can researchers effectively design experiments to study the co-evolutionary patterns in psbA genes?

To study co-evolutionary patterns in psbA genes, researchers should implement a comprehensive approach that combines molecular phylogenetics, sequence analysis, and structural biology. Begin by sequencing psbA genes from multiple fern species across different orders to ensure taxonomic breadth. Implement statistical methods such as mutual information analysis, structural equation modeling, and Bayesian graphical models to identify co-evolving residues. Computational approaches should include tests for selection (dN/dS ratios) and analysis of biochemical constraints on amino acid substitutions. Validate computational findings through site-directed mutagenesis experiments, analyzing the impact of mutations on protein function and stability through biochemical assays. This integrative approach can reveal significant functional/structural communications between co-evolving sites in the D1 protein .

What protocols are most effective for analyzing selective pressure on duplicated psbA genes in ferns?

For analyzing selective pressure on duplicated psbA genes in ferns, researchers should implement a comparative genomics approach. First, sequence both psbA copies from multiple leptosporangiate fern species, ensuring proper alignment of orthologous sequences. Employ codon-based models in software packages like PAML, HyPhy, or CodeML to calculate dN/dS ratios across branches and sites. Implement branch-site models to detect episodic positive selection specific to particular lineages.

Analysis MethodApplicationOutput MetricsInterpretive Value
Site Models (M0, M1a, M2a, M7, M8)Detect sites under selectionLog-likelihood scores, BEB posterior probabilitiesIdentifies specific amino acid positions under selection
Branch ModelsTest selection across lineagesω values for foreground/background branchesDetects lineage-specific selection pressures
Branch-site ModelsDetect sites under selection in specific lineagesSite-specific ω values, BEB posterior probabilitiesIdentifies episodic selection at specific sites
BUSTEDTest for gene-wide episodic diversifying selectionEvidence ratios, p-valuesIndicates if gene experienced positive selection

Complement sequence-based analyses with structural mapping of selected sites onto 3D protein models to evaluate functional implications. Include additional tests for relaxed selection using RELAX software to determine if selective constraints have been relaxed after duplication in certain lineages .

How does the formation of phragmosome-like structures in Adiantum capillus-veneris relate to psbA function?

While direct evidence linking phragmosome-like (PS-like) structures to psbA function in Adiantum capillus-veneris is limited, these cellular structures provide important context for understanding the cellular environment in which psbA operates. Research has demonstrated that PS-like structures develop at the site of preprophase bands (PPBs) of microtubules when cellular components are displaced. These structures contain essential cellular elements including endoplasmic microtubules, F-actin, oil droplets, and mitochondria. The formation of these structures is inhibited when cells are treated with amiprophos-methyl (APM) before PPB formation, and interestingly, APM treatment after PS-like structure formation arrests the cell cycle at M phase and inhibits structure degradation. This suggests a complex interplay between cellular organization, the cell cycle, and potentially photosynthetic function where psbA products operate .

What is known about the selective constraints on D1 protein after gene duplication in leptosporangiate ferns?

Following gene duplication of psbA in leptosporangiate ferns, selective constraints on the D1 protein were found to be relaxed in four leptosporangiate orders. This relaxation suggests reduced evolutionary pressure on maintaining the exact protein sequence, potentially allowing for functional diversification. Interestingly, while positively selected codons were detected in species with single copy psbA, no such positively selected sites were found in species with duplicated psbA genes. This pattern indicates different evolutionary trajectories for single versus duplicated genes. Additionally, several sites within the D1 protein were identified as being involved in co-evolutionary processes, suggesting significant functional or structural communications between these amino acid positions. These findings point to a complex evolutionary history shaped by competition with angiosperms for light resources, which may have driven continuous fixation of adaptive amino acid changes in the psbA gene, particularly after duplication .

How do environmental factors influence expression levels of duplicated psbA genes in Adiantum capillus-veneris?

Environmental factors significantly modulate the expression patterns of duplicated psbA genes in Adiantum capillus-veneris through complex regulatory mechanisms. Research indicates that light intensity, spectral quality, temperature fluctuations, and water availability differentially affect the expression of psbA paralogs. Under high light stress conditions, one paralog may be preferentially expressed to mitigate photodamage, while the other may dominate under shade conditions where light harvesting efficiency is prioritized.

For investigating these expression patterns, researchers should employ a multi-faceted approach including:

  • Quantitative RT-PCR with paralog-specific primers to measure relative expression levels under controlled environmental conditions

  • RNA-seq analysis to capture genome-wide expression patterns that may reveal co-regulated genes

  • Chromatin immunoprecipitation (ChIP) assays to identify transcription factors involved in differential regulation

  • Promoter analysis to characterize cis-regulatory elements that respond to environmental signals

These methodologies can elucidate how subfunctionalization or neofunctionalization of duplicated psbA genes contributes to the remarkable adaptation of ferns across diverse ecological niches .

What are the molecular mechanisms underlying the preserved functionality of both psbA copies in leptosporangiate ferns?

The preserved functionality of both psbA copies in leptosporangiate ferns likely stems from multiple molecular mechanisms that prevent the typical fate of duplicated genes (pseudogenization). Based on evolutionary analyses, several hypotheses have emerged: (1) Subfunctionalization has partitioned ancestral functions between paralogs, with each copy specializing in different aspects of photosynthesis or different developmental stages; (2) Neofunctionalization has allowed one copy to evolve novel functions while the other maintains original functions; (3) Dosage selection maintains both copies to ensure sufficient D1 protein production for optimal photosynthetic efficiency.

To investigate these mechanisms, researchers should conduct comprehensive functional analyses including:

  • Site-directed mutagenesis of key residues identified in co-evolutionary analyses

  • Heterologous expression systems to test functional differences between paralogs

  • Protein-protein interaction studies to map differences in binding partners

  • Photosynthetic performance measurements in transgenic systems where expression of individual paralogs is manipulated

Understanding these mechanisms has broader implications for evolutionary biology and could inform strategies for engineering enhanced photosynthetic efficiency in crop plants .

How does the antioxidant activity of Adiantum capillus-veneris extracts affect the stability and function of recombinant psbA protein?

The potent antioxidant properties of Adiantum capillus-veneris extracts likely play a significant role in protecting the recombinant psbA protein from oxidative damage. Research has demonstrated that extracts from this fern species exhibit antioxidant capacity superior to some synthetic antioxidants like BHT, EDTA, and ascorbic acid. These extracts have been shown to inhibit lipid peroxidation and increase the level of antioxidant enzymes including superoxide dismutase (SOD), catalase (CAT), glutathione peroxidase (GPx), and glutathione content .

For recombinant psbA protein research, this presents both methodological considerations and research opportunities:

  • Inclusion of fern-derived antioxidants in extraction and purification buffers may improve protein stability and functional yield

  • Co-expression systems incorporating antioxidant elements from Adiantum capillus-veneris may enhance recombinant protein quality

  • Investigation of specific antioxidant compounds (carvone, carvacrol, and thymol from essential oils) for their protective effects on photosystem components

  • Analysis of how these antioxidant properties might contribute to the evolutionary preservation of duplicated psbA genes in natural environments

Researchers should design comparative stability studies measuring activity retention of recombinant psbA protein preparations with and without fern-derived antioxidant supplementation under various storage and experimental conditions .

How can understanding psbA evolution in Adiantum capillus-veneris inform photosynthetic engineering in other plants?

The unique evolutionary history of psbA in Adiantum capillus-veneris and other ferns provides valuable insights for photosynthetic engineering. The preservation of duplicated psbA genes in leptosporangiate ferns, along with the detection of positively selected codons in single-copy variants, points to adaptive mechanisms that could be leveraged for crop improvement. Researchers should examine the specific amino acid changes that have been fixed during fern evolution, especially those involved in co-evolutionary processes, as these may represent solutions to photosynthetic efficiency under different environmental conditions.

For applied research, prioritize the following approaches:

  • Site-directed mutagenesis to introduce fern-specific adaptive residues into crop plant D1 proteins

  • Creation of synthetic D1 variants that incorporate beneficial features from both duplicated fern genes

  • Regulatory analysis to understand how ferns control expression of duplicate genes under different environmental stresses

  • Investigation of whether duplicated D1 proteins could enhance photosystem repair cycles in crops

These strategies could lead to crops with improved photosynthetic efficiency, particularly under stress conditions, by incorporating evolutionary innovations that emerged during the long competitive history between ferns and angiosperms for light resources .

What research methodologies combine insights from medicinal properties and molecular evolution of Adiantum capillus-veneris?

An integrative research methodology that combines medicinal properties and molecular evolution of Adiantum capillus-veneris requires a multi-disciplinary approach spanning ethnobotany, evolutionary genomics, and pharmacology. This approach leverages the rich medicinal history of the plant alongside its unique evolutionary adaptations.

A comprehensive framework should include:

  • Phylogenomics analysis to correlate the evolution of medicinal compounds with adaptations in photosynthetic genes

    • Sequence psbA and related genes across Adiantum species with varying medicinal properties

    • Perform ancestral state reconstruction to track the emergence of key bioactive compounds

  • Metabolomics profiling coordinated with transcriptomics

    • Compare metabolite profiles between species with divergent psbA sequences

    • Correlate expression patterns of duplicated psbA genes with production of medicinal compounds

  • Structure-function analysis of bioactive compounds in relation to photosynthetic efficiency

    • Investigate whether compounds with antibacterial, anti-inflammatory, or antioxidant properties (like carvone, carvacrol, and thymol) play roles in protecting photosynthetic machinery

    • Examine whether these compounds are differentially produced under conditions that stress photosystems

  • Targeted genetic modification experiments

    • Manipulate psbA expression and measure impacts on medicinal compound production

    • Use CRISPR/Cas9 to edit key residues identified through evolutionary analysis and assess effects on both photosynthetic function and medicinal properties

This integrated approach can reveal whether the medicinal properties of Adiantum capillus-veneris evolved in conjunction with its photosynthetic adaptations, potentially uncovering new bioactive compounds with therapeutic applications .

What are the critical factors to consider when designing recombinant expression systems for Adiantum capillus-veneris psbA?

When designing recombinant expression systems for Adiantum capillus-veneris psbA, researchers must address several critical factors to ensure successful protein production and functionality. The D1 protein encoded by psbA is a transmembrane protein integrated into the thylakoid membrane, making its expression particularly challenging.

Key considerations include:

  • Expression host selection:

    • Cyanobacterial hosts (e.g., Synechocystis sp.) offer native photosynthetic machinery

    • Plant chloroplast transformation systems provide a native-like environment

    • E. coli systems require optimization for membrane protein expression (using strains like C41/C43)

  • Codon optimization:

    • Analyze codon usage bias between Adiantum capillus-veneris and the expression host

    • Optimize rare codons while preserving regulatory elements

    • Consider the impact of codon optimization on translation rate and protein folding

  • Fusion partners and solubility tags:

    • N-terminal fusions with maltose-binding protein (MBP) or SUMO can enhance solubility

    • C-terminal His-tags allow purification while minimizing interference with N-terminal processing

    • Include TEV or PreScission protease sites for tag removal

  • Membrane integration strategies:

    • Co-expression with chlorophyll synthesis pathways if using heterologous systems

    • Inclusion of native thylakoid targeting sequences

    • Supplementation with lipids that mimic thylakoid membrane composition

  • Expression conditions:

    • Light cycling regimes that mimic natural conditions

    • Temperature optimization (typically lower temperatures improve folding)

    • Induction strategies that allow slow accumulation to prevent aggregation

Each of these factors should be systematically optimized through factorial experimental design to identify the most effective combination for producing functional recombinant psbA protein .

How can researchers effectively investigate the relationship between phragmosome-like structures and photosystem function in Adiantum capillus-veneris?

To effectively investigate the relationship between phragmosome-like (PS-like) structures and photosystem function in Adiantum capillus-veneris, researchers should implement a multi-technique approach that integrates cellular biology, biochemistry, and advanced imaging. Since PS-like structures develop at the site of preprophase bands (PPBs) when cellular components are displaced, this suggests potential spatial regulation of cellular components that may impact photosynthetic function.

Recommended methodological approach:

  • Live-cell imaging techniques:

    • Employ confocal microscopy with fluorescent protein fusions to D1 and other PSII components

    • Use photoactivatable fluorescent proteins to track protein movement during PS-like structure formation

    • Implement super-resolution microscopy (STORM/PALM) to visualize nanoscale organization

  • Targeted manipulation of PS-like structures:

    • Apply centrifugation protocols described in the literature to induce PS-like structure formation

    • Use amiprophos-methyl (APM) treatments to manipulate the formation and dispersal of these structures

    • Develop optogenetic tools to induce localized PS-like structure formation

  • Functional measurements:

    • Perform chlorophyll fluorescence analyses before, during, and after PS-like structure formation

    • Measure oxygen evolution rates to assess PSII activity in cells with and without PS-like structures

    • Use microelectrodes to detect localized changes in photosynthetic electron transport

  • Biochemical isolation and analysis:

    • Develop protocols to isolate intact PS-like structures

    • Perform proteomics analysis to identify photosystem components within these structures

    • Conduct activity assays on isolated structures to assess their functional capacity

  • Correlative microscopy:

    • Combine fluorescence imaging with electron microscopy to relate ultrastructure to protein localization

    • Implement cryo-electron tomography to visualize 3D arrangements of photosystems in relation to PS-like structures

This comprehensive approach will help elucidate whether PS-like structures serve as organizing centers for photosystem assembly, maintenance, or repair, potentially revealing new insights into the spatial regulation of photosynthesis in ferns .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.