Recombinant Aedes aegypti Aquaporin AQPAe.a (AAEL003512)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AAEL003512; Aquaporin AQPAe.a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
Target Names
AAEL003512
Target Protein Sequence
MTESAGVKQLVGVADITENRNIWRMLVAEFLGTFFLVSIGIGSTMGWGGDYAPTMTQIAFTFGLVVATLAQAFGHVSGCHINPAVTIGLMITADISILKGAFYIVSQCVGAIAGAALIKAATPSDVIGGLGVTGIDPRLTAGQGVMIEALITFILVFVVHGVCDNRRSDIKGSAPLAIGLSITAGHLSAIKYTGASMNPARSFGPAVVMGNWTDQWVYWVGPIVGGILAGAVYRLFFKVRKGDEESYDF
Uniprot No.

Target Background

Function

Forms a water-specific channel.

Database Links

STRING: 7159.AAEL003512-PA

UniGene: Aae.18353

Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Localized in tracheolar cells associated with the Malpighian tubules.

Q&A

What is the molecular structure of AQPAe.a (AAEL003512) and how does it relate to other aquaporins in Aedes aegypti?

AQPAe.a (AAEL003512) is one of six identified aquaporin genes in Aedes aegypti (AQP1-6). Aquaporins are transmembrane proteins that form selective channels primarily for water transport, though some also transport small solutes such as glycerol and trehalose . Phylogenetic analysis indicates that five of the six Ae. aegypti AQPs have high similarity to classical water-transporting AQPs found in vertebrates . The functional characterization of these proteins reveals that AQP1, 2, and 5 allow significant water permeability, while AQP4 and 5 have been identified as entomoglyceroporins capable of transporting small solutes in addition to water .

What are the expression patterns of AQPAe.a in different tissues of Aedes aegypti?

The six aquaporins in Ae. aegypti show distinct expression patterns across different tissues. AQP1, 4, and 5 are strongly expressed in the Malpighian tubules (MTs) of adult female mosquitoes . Using fluorescence in situ hybridization, research has demonstrated that aqp1 mRNA is found exclusively in the principal cells of female MTs . The expression patterns of aquaporins vary across developmental stages and physiological conditions, notably changing after blood feeding events .

Table 1: Expression patterns of Aedes aegypti aquaporins in key tissues

AquaporinMalpighian TubulesMidgutHindgutFat Body
AQP1HighLowModerateLow
AQP2LowModerateLowLow
AQP4HighLowLowModerate
AQP5HighModerateModerateLow
AQP6ModerateLowLowLow

Note: Expression levels based on compiled research data

What functional roles does AQPAe.a play in mosquito physiology?

AQPAe.a plays a critical role in water regulation and excretion in Ae. aegypti, particularly following blood meals. After blood feeding, female mosquitoes must rapidly excrete excess water and ions through their excretory system, primarily the Malpighian tubules . AQPs facilitate the transcellular water flow necessary for this rapid diuresis. RNAi-mediated knockdown studies have demonstrated that depleting MT-expressed aquaporins (AQP1, 4, and 5) significantly reduces diuresis , confirming their critical function in water regulation. This process begins within seconds after the mosquito starts feeding and is essential for maintaining homeostasis after ingesting more than the mosquito's body weight in blood .

What methodologies are most effective for expressing recombinant AQPAe.a for functional studies?

For expressing recombinant AQPAe.a, a comprehensive approach involving multiple expression systems yields the most reliable results. For initial characterization, bacterial expression systems using E. coli (particularly BL21(DE3) strains) with pET vector systems provide efficient protein production, though proper folding may be challenging. For functional studies, Xenopus laevis oocyte expression systems have proven particularly effective for aquaporin research .

Methodology protocol:

  • Clone the full-length cDNA of AQPAe.a into an appropriate expression vector (pGEM T-Easy for bacterial cloning, pGEMHE for oocyte expression)

  • For bacterial expression, transform into competent E. coli cells and induce with IPTG

  • For functional studies in Xenopus oocytes:

    • Linearize the construct and transcribe using T7 RNA polymerase

    • Inject 5-10 ng of cRNA into defolliculated oocytes

    • After 3-4 days of expression, conduct functional assays including osmotic swelling tests

  • Purify recombinant protein using affinity chromatography with a polyhistidine tag

  • Verify protein expression by Western blotting using specific antibodies

How do subcellular localization patterns of AQPAe.a change in response to blood feeding?

The subcellular localization of AQPAe.a undergoes dynamic changes in response to blood feeding, reflecting its crucial role in post-blood meal diuresis. Using immunogold staining with transmission electron microscopy, researchers have determined that AQP1 is predominantly found in the principal cells of the Malpighian tubules under non-blood fed conditions, dispersed throughout the brush border, with some localization also observed in stellate cells .

Following blood feeding, significant changes in aquaporin localization occur:

  • At 0.5 hours post-blood meal (PBM): Increased localization to the apical membrane of principal cells

  • At 24 hours PBM: Partial redistribution to intracellular vesicles and basolateral membranes

These trafficking patterns suggest a regulatory mechanism for water transport that responds to the physiological demands of blood digestion and excretion. The translocation of aquaporins to specific membrane domains likely facilitates directional water flow during the different phases of blood meal processing .

What are the most effective strategies for RNAi-mediated knockdown of AQPAe.a to study functional impacts?

For effective RNAi-mediated knockdown of AQPAe.a, the following protocol has proven successful in research settings:

  • Design dsRNA targeting unique regions of the AQPAe.a transcript (typically 300-500 bp fragments), avoiding conserved domains shared with other aquaporins

  • Synthesize dsRNA using T7 RNA polymerase-based transcription systems

  • For adult mosquitoes, inject 1-2 μg of dsRNA in a volume of 0.1-0.2 μL into the thorax

  • Allow 3-5 days for optimal knockdown efficiency

  • Confirm knockdown efficiency using qRT-PCR and Western blotting

  • Assess physiological impacts through:

    • Diuresis rate measurements using precision weighing before and after blood feeding

    • Fluid secretion assays with isolated Malpighian tubules

    • Dye clearance assays to track excretion rates

RNAi-mediated knockdown studies have demonstrated that depleting MT-expressed aquaporins results in significantly reduced diuresis, confirming their essential role in water transport following blood meals .

What immunohistochemical techniques provide optimal results for localizing AQPAe.a in mosquito tissues?

For optimal immunohistochemical localization of AQPAe.a in mosquito tissues, the following protocol yields reliable results:

  • Tissue preparation:

    • Dissect tissues from 10-15 female Ae. aegypti (aged 10-12 days post-emergence)

    • Fix tissues in 4% paraformaldehyde for 1 hour at room temperature

    • Wash five times with sterile PBT (PBS + 0.1% Tween-20)

    • Quench with 1% H₂O₂ for 20 minutes to reduce background fluorescence

    • Permeabilize using 4% Triton X-100 for 1 hour

  • Antibody processing:

    • Block in 5% normal goat serum in PBT for 1 hour

    • Incubate with primary antibody (anti-AQPAe.a, typically 1:500 dilution) overnight at 4°C

    • Wash extensively with PBT

    • Incubate with fluorescently-labeled secondary antibodies for 2 hours at room temperature

    • Counter-stain nuclei with DAPI

  • Imaging:

    • Mount tissues in anti-fade mounting medium

    • Image using confocal microscopy with appropriate laser settings

    • Acquire Z-stacks for three-dimensional analysis of protein distribution

How can heterologous expression systems be optimized for functional characterization of AQPAe.a?

Optimizing heterologous expression systems for functional characterization of AQPAe.a requires addressing several key parameters:

  • Xenopus oocyte expression system:

    • Use codon-optimized constructs for improved translation efficiency

    • Maintain oocytes at 18°C in modified Barth's solution supplemented with antibiotics

    • For water permeability assays, subject oocytes to hypotonic challenge and monitor volume changes

    • For solute transport studies, measure uptake of radiolabeled glycerol or other potential substrates

  • Insect cell expression (Sf9 or High Five cells):

    • Utilize baculovirus expression system with polyhistidine tag for purification

    • Optimize infection multiplicity and expression time (typically 48-72 hours)

    • Verify protein localization to plasma membrane using membrane fractionation

    • Extract membrane proteins using mild detergents (n-Dodecyl β-D-maltoside)

  • Functional assays:

    • Water permeability: Stopped-flow light scattering technique with membrane vesicles

    • Solute transport: Radiotracer uptake studies

    • Inhibitor sensitivity: Test mercury compounds and other known aquaporin blockers

The heterologous expression data have confirmed that AQP1, 2, and 5 demonstrate significant water permeability, with AQP5 showing comparable permeability to AQP1 .

What are the most accurate methods for quantifying AQPAe.a protein abundance changes following physiological challenges?

For accurate quantification of AQPAe.a protein abundance changes following physiological challenges such as blood feeding, a multi-technique approach is recommended:

  • Western blotting:

    • Isolate specific tissues (e.g., Malpighian tubules) from mosquitoes under different conditions

    • Extract proteins using RIPA buffer with protease inhibitors

    • Separate proteins by SDS-PAGE and transfer to PVDF membranes

    • Probe with specific anti-AQPAe.a antibodies

    • Use β-actin or other housekeeping proteins as loading controls

    • Quantify band intensity using densitometry software

  • Mass spectrometry-based quantification:

    • Employ SILAC (Stable Isotope Labeling with Amino Acids in Cell Culture) or TMT (Tandem Mass Tag) approaches

    • Process samples using nano-LC-MS/MS

    • Analyze data using specialized proteomics software

  • Immunofluorescence quantification:

    • Process tissues as described in the immunohistochemical protocol

    • Capture images using identical acquisition parameters

    • Measure fluorescence intensity in defined regions of interest

    • Normalize to cell number or tissue area

These methods have revealed that AQP1 abundance in Malpighian tubules changes significantly following blood feeding, with increases observed at 0.5 hours post-blood meal, correlating with the period of rapid diuresis .

How can AQPAe.a be targeted for vector control strategies?

AQPAe.a represents a promising target for vector control strategies due to its essential role in mosquito water homeostasis, particularly following blood meals. Several approaches show potential:

  • Small molecule inhibitors:

    • Screen for compounds that selectively block AQPAe.a but not human aquaporins

    • Prioritize molecules with physicochemical properties suitable for topical application

    • Test efficacy in reducing diuresis in live mosquitoes

  • RNA interference-based approaches:

    • Develop dsRNA delivery systems (e.g., nanoparticles, symbiotic bacteria)

    • Design mosquito baits containing AQPAe.a-targeting dsRNA

    • Target multiple aquaporins simultaneously for synergistic effects

  • CRISPR/Cas9 gene drive systems:

    • Design gene drives targeting AQPAe.a to reduce functional protein expression

    • Model population-level impacts of reduced female feeding capacity

These approaches have significant potential as AQPAe.a is critical for post-blood meal diuresis, and disrupting this process would likely reduce mosquito survival and reproduction after feeding .

How does AQPAe.a function differ between insecticide-resistant and susceptible Aedes aegypti strains?

Comparing AQPAe.a function between insecticide-resistant and susceptible Ae. aegypti strains requires a comprehensive approach:

  • Comparative expression analysis:

    • Quantify mRNA levels using qRT-PCR across multiple tissues

    • Determine protein abundance using western blotting

    • Assess subcellular localization patterns using immunofluorescence microscopy

  • Functional characterization:

    • Measure diuresis rates in both strains following blood meals

    • Evaluate water and solute permeability in isolated tubules

    • Test sensitivity to AQP inhibitors

  • Sequence analysis:

    • Identify polymorphisms in the AQPAe.a gene sequence

    • Model potential structural changes using homology modeling

    • Assess impact of mutations on channel function

While specific data comparing resistant and susceptible strains is limited, this research direction may reveal whether changes in aquaporin function contribute to the physiological adaptations observed in insecticide-resistant mosquitoes.

What is the relationship between AQPAe.a expression and viral infection in Aedes aegypti?

The relationship between AQPAe.a expression and viral infection in Ae. aegypti represents an emerging area of research with significant implications for understanding vector competence:

  • Expression changes during infection:

    • Monitor AQPAe.a mRNA and protein levels at different time points post-infection

    • Compare expression patterns across different tissues, particularly midgut and salivary glands

    • Examine multiple viruses including dengue and yellow fever

  • Functional impacts:

    • Assess whether viral infection alters water transport efficiency

    • Determine if changes in AQPAe.a expression affect viral replication or dissemination

    • Evaluate whether AQPAe.a knockdown influences viral infection success

  • Mechanistic studies:

    • Investigate whether viral proteins directly interact with AQPAe.a

    • Determine if viruses manipulate AQPAe.a trafficking pathways

    • Explore whether inflammation responses modulate aquaporin expression

This research area may reveal unexpected roles for aquaporins in the virus-vector relationship, potentially identifying new targets for interrupting disease transmission.

What are the most promising approaches for developing selective inhibitors of AQPAe.a?

Developing selective inhibitors of AQPAe.a requires a multi-faceted approach:

  • Structure-based drug design:

    • Generate high-resolution 3D models of AQPAe.a using homology modeling and/or cryo-EM

    • Perform virtual screening of compound libraries targeting the pore region

    • Identify compounds that exploit structural differences between mosquito and human aquaporins

  • High-throughput screening approaches:

    • Develop cell-based assays using fluorescent indicators of cell volume changes

    • Screen natural product libraries for compounds with selective activity

    • Employ fragment-based drug discovery to identify novel scaffolds

  • Peptide-based inhibitors:

    • Design peptides that mimic conserved loops of AQPAe.a

    • Create cyclized peptides for improved stability

    • Test peptide-conjugated nanoparticles for enhanced delivery

The development of selective inhibitors could provide valuable research tools and potentially lead to new vector control strategies targeting the critical process of post-blood meal diuresis .

How does the glycosylation pattern of recombinant AQPAe.a affect its functional properties?

The glycosylation pattern of recombinant AQPAe.a significantly impacts its functional properties, with implications for both research applications and physiological understanding:

  • Glycosylation analysis:

    • Identify N-glycosylation sites using predictive algorithms and mass spectrometry

    • Compare glycosylation patterns between native and recombinant proteins

    • Analyze glycan structures using specialized glycomics approaches

  • Functional impact assessment:

    • Generate glycosylation site mutants (N→Q substitutions)

    • Compare water and solute permeability between wild-type and mutant proteins

    • Evaluate protein stability and trafficking efficiency

  • Expression system optimization:

    • Compare insect cells (more native-like glycosylation) with mammalian expression systems

    • Utilize glycoengineered cell lines for controlled glycosylation

    • Employ enzymatic deglycosylation to generate protein variants

Understanding the role of glycosylation in AQPAe.a function could provide insights into post-translational regulation and improve the production of functionally relevant recombinant protein for research applications.

What role does AQPAe.a play in Aedes aegypti desiccation resistance and overwinter survival?

The role of AQPAe.a in desiccation resistance and overwinter survival represents an important but understudied aspect of Ae. aegypti biology:

  • Seasonal expression patterns:

    • Compare AQPAe.a expression levels across seasons and environmental conditions

    • Analyze tissue-specific expression changes during periods of water stress

    • Examine potential epigenetic regulation in response to environmental cues

  • Functional studies:

    • Measure survival rates of AQPAe.a knockdown mosquitoes under desiccation stress

    • Assess water loss rates in modified mosquitoes using gravimetric analysis

    • Evaluate freeze tolerance in relation to aquaporin expression levels

  • Population studies:

    • Compare AQPAe.a sequences and expression patterns between tropical and temperate populations

    • Identify potential adaptive mutations in populations from different climatic regions

    • Model how AQPAe.a variants might influence geographical range expansion

This research direction could provide valuable insights into the adaptive mechanisms that allow Ae. aegypti to survive in diverse environments and potentially identify new vulnerabilities for population control strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.