Recombinant Aedes aegypti Band 7 protein AAEL010189 (AAEL010189)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize development of your specified tag.
Synonyms
AAEL010189; Band 7 protein AAEL010189
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-297
Protein Length
full length protein
Species
Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
Target Names
AAEL010189
Target Protein Sequence
MGVVESITNSTKPGVTKKSSPEAEDDSNGEASTCGRILIFLSWVLVVLTMPFSLLVCFKV VQEYERAVIFRLGRLVQGGAKGPGIFFILPCIDAYARVDLRTRTYDVPPQEVLTKDSVTV SVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGSMQL SLDEATEAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALRE ASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPIDILTYFMKSKESYEASHSHS
Uniprot No.

Target Background

Database Links
Protein Families
Band 7/mec-2 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Aedes aegypti Band 7 protein AAEL010189?

Recombinant Aedes aegypti Band 7 protein AAEL010189 is a 297 amino acid protein (UniProt ID: Q16TM5) derived from the yellow fever mosquito. It belongs to the Band 7/SPFH (Stomatin/Prohibitin/Flotillin/HflK/C) domain protein family, which typically associates with membrane microdomains and participates in cellular processes including membrane organization and potential signaling functions. The full-length protein (1-297aa) has been successfully expressed with an N-terminal His tag in E. coli expression systems .

What are the physical properties of recombinant AAEL010189?

The recombinant AAEL010189 protein has the following characteristics:

PropertySpecificationNotes
Amino Acid Length297 amino acids (full-length)Also available as partial protein
Molecular TagsN-terminal His tagFor purification and detection purposes
Expression SystemsE. coli, Cell-free, Yeast, Baculovirus, or Mammalian CellMultiple expression options available
Physical FormLyophilized powderRequires reconstitution before use
Purity≥85-90% by SDS-PAGEVaries slightly between suppliers
Amino Acid SequenceMGVVESITNSTKPGVTKKSSPEAEDDSNGEASTCGRILIFLSWVLVVLTMPFSLLVCFKV VQEYERAVIFRLGRLVQGGAKGPGIFFILPCIDAYARVDLRTRTYDVPPQEVLTKDSVTV SVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGSMQL SLDEATEAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALRE ASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPIDILTYFMKSKESYEASHSHSFull sequence as determined by genomic analysis

What are the optimal storage and handling conditions for recombinant AAEL010189?

For maximum stability and activity retention of recombinant AAEL010189, researchers should follow these methodological guidelines:

  • Storage temperature: Store at -20°C or preferably -80°C upon receipt

  • Aliquoting: Divide into single-use aliquots to avoid repeated freeze-thaw cycles

  • Working stock: Aliquots can be stored at 4°C for up to one week for ongoing experiments

  • Reconstitution procedure:

    • Centrifuge vial briefly before opening to collect material at the bottom

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration for long-term storage

    • Standard practice uses 50% glycerol final concentration

The reconstituted protein should be stored in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 to maintain stability. Repeated freeze-thaw cycles significantly reduce protein activity and should be strictly avoided .

How should researchers design experiments to characterize AAEL010189 function?

When designing experiments to investigate AAEL010189 function, researchers should apply rigorous methodology principles:

  • Start with clearly defined research questions and hypotheses

  • Incorporate appropriate controls (positive, negative, and procedural)

  • Ensure adequate sample size through power analysis

  • Define dependent and independent variables precisely

  • Control for confounding variables

A comprehensive experimental approach for AAEL010189 characterization might include:

Experimental ApproachMethodological ConsiderationsExpected Outcomes
Structural analysisX-ray crystallography, NMR, or computational modeling3D structure revealing functional domains and binding sites
Subcellular localizationFluorescent tagging, immunocytochemistryDetermination of cellular compartment where protein functions
Protein-protein interactionsCo-immunoprecipitation, yeast two-hybrid assaysIdentification of binding partners and complex formation
Site-directed mutagenesisTargeted modification of key residuesIdentification of functional amino acids essential for activity
Expression profilingqRT-PCR, RNA-seq across developmental stagesTemporal and spatial expression patterns in mosquito life cycle
Functional knockdownRNAi or CRISPR-based approachesPhenotypic effects revealing physiological roles

Researchers should carefully document all experimental parameters to ensure reproducibility, including protein concentration, buffer composition, temperature, incubation times, and equipment specifications .

What purification strategies are most effective for recombinant AAEL010189?

Given the His-tagged nature of recombinant AAEL010189, the following methodological purification workflow is recommended:

  • Cell lysis optimization:

    • Use mild detergents (0.1-1% Triton X-100) if membrane association is suspected

    • Include protease inhibitor cocktail to prevent degradation

    • Perform lysis under native conditions (pH 7.5-8.0) to preserve protein structure

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Use Ni-NTA resin for His-tagged protein capture

    • Apply stepwise imidazole gradient (10-20 mM in wash buffer, 250-300 mM in elution buffer)

    • Monitor protein elution by UV absorbance (280 nm)

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates and ensure homogeneity

    • Consider ion exchange chromatography for removing contaminants

  • Quality control assessment:

    • SDS-PAGE analysis to verify purity (target >90% for most applications)

    • Western blotting to confirm identity

    • Dynamic light scattering to assess homogeneity

    • Circular dichroism to confirm proper folding

The purification protocol should be optimized specifically for AAEL010189, as Band 7 proteins often have hydrophobic regions that may affect solubility and purification efficiency .

How can researchers address expression challenges with AAEL010189?

Expression of full-length AAEL010189 presents system-specific challenges requiring methodological approaches:

Expression SystemPotential ChallengesMethodological Solutions
E. coliMembrane protein solubility issues, inclusion body formation- Lower induction temperature (16-20°C)
- Use specialized strains (C41/C43)
- Add solubility enhancers (0.5-1% Triton X-100)
- Optimize codon usage for E. coli
Cell-freeLower yield, higher cost- Supplement with membrane mimetics
- Add molecular chaperones
- Optimize reaction components
Eukaryotic systemsPost-translational modification differences, lower yield- Verify glycosylation profile
- Optimize codon usage for host
- Confirm protein trafficking

When selecting an expression system, researchers should consider how the system might affect protein folding, post-translational modifications, and biological activity. The presence of hydrophobic regions in the AAEL010189 sequence suggests potential membrane association, which may require specialized expression strategies for optimal results .

What approaches are recommended for studying AAEL010189 structure-function relationships?

To elucidate structure-function relationships of AAEL010189, researchers should employ a multi-technique approach:

  • Computational analysis:

    • Bioinformatic comparison with characterized Band 7 proteins

    • Identification of conserved domains and motifs

    • Prediction of transmembrane regions and secondary structure elements

  • Experimental structure determination:

    • X-ray crystallography (requires crystallization optimization)

    • Cryo-electron microscopy (for potential membrane-associated state)

    • Nuclear Magnetic Resonance (for specific domains)

    • Circular dichroism for secondary structure content estimation

  • Functional mapping:

    • Generation of truncation constructs to identify minimal functional domains

    • Site-directed mutagenesis of conserved residues

    • Creation of chimeric proteins with other Band 7 family members

  • Biological validation:

    • Expression of mutants in model systems

    • Phenotypic rescue experiments

    • Binding assays with identified interaction partners

These approaches should be integrated within a systematic research methodology that progresses from in silico predictions to in vitro validation and ultimately in vivo functional studies, with each step informing subsequent experiments .

How can researchers validate the specificity of results obtained with His-tagged AAEL010189?

His-tagged proteins can introduce experimental artifacts that must be methodologically addressed:

  • Tag interference controls:

    • Compare results between N-terminal and C-terminal His-tagged variants

    • Generate tag-free protein through protease cleavage (if TEV site is present)

    • Use alternative tagging strategies (GST, MBP, FLAG) for comparative analysis

  • False positive interaction controls:

    • Include appropriate concentrations of imidazole (10-20 mM) in binding assays

    • Perform parallel experiments with unrelated His-tagged proteins

    • Validate key findings with tag-free protein

  • Structural validation:

    • Assess whether tag affects protein folding using circular dichroism

    • Compare thermal stability between tagged and untagged versions

    • Validate function using activity assays with both protein forms

  • Biological validation:

    • Confirm that tagged protein complements knockout/knockdown models

    • Compare localization patterns between tagged and antibody-detected native protein

What methodological approaches can reveal AAEL010189's role in mosquito biology?

To investigate the physiological role of AAEL010189 in Aedes aegypti, researchers should employ these methodological strategies:

  • Spatiotemporal expression analysis:

    • Stage-specific expression using qRT-PCR across developmental stages

    • Tissue-specific expression using in situ hybridization

    • Expression response to environmental stressors (temperature, insecticides)

    • Sex-specific expression patterns

  • Genetic manipulation approaches:

    • CRISPR/Cas9-mediated gene knockout

    • Conditional knockdown using tissue-specific drivers

    • Rescue experiments with wild-type and mutant variants

    • Overexpression studies to identify gain-of-function phenotypes

  • Physiological assessment:

    • Impact on blood-feeding behavior

    • Effects on reproduction and development

    • Resistance to environmental stressors

    • Vector competence for relevant pathogens

  • Molecular mechanism studies:

    • Identification of interacting proteins in mosquito tissues

    • Membrane organization and microdomain studies

    • Potential ion channel regulation (common for Band 7 proteins)

    • Comparison with orthologous proteins in other disease vectors

These approaches should be integrated within a comprehensive research program that connects molecular mechanisms to physiological outcomes and potential vector control applications .

What are the recommended experimental controls when working with recombinant AAEL010189?

Control TypeExamplesMethodological Purpose
Negative controls- Empty vector expression product
- Irrelevant His-tagged protein
- Heat-denatured AAEL010189
Distinguish specific effects from non-specific binding or contamination artifacts
Positive controls- Well-characterized related Band 7 protein
- Native AAEL010189 (if available)
- Synthetic positive control for specific assays
Validate assay functionality and provide reference points for activity
Technical controls- Multiple protein concentrations
- Time course measurements
- Different buffer conditions
- Technical replicates
Establish dose-dependency, kinetics, and statistical significance
Biological controls- Multiple expression batches
- Different expression systems
- Biological replicates
Control for batch effects and system-specific artifacts
Tag controls- Tagged vs untagged protein
- Alternative tag placements
- Different tag types
Distinguish protein effects from tag-induced artifacts

Researchers should document all control experiments systematically and include them in publications to demonstrate the specificity and reliability of their findings. The experimental design should incorporate controls at each stage, from protein production to functional analysis .

How can findings from AAEL010189 research contribute to broader scientific knowledge?

Research on AAEL010189 can contribute to multiple fields through these methodological approaches:

  • Vector biology advancements:

    • Identification of novel physiological pathways in disease vectors

    • Potential targets for innovative vector control strategies

    • Understanding of mosquito membrane biology and organization

  • Comparative protein family analysis:

    • Insights into Band 7/SPFH protein evolution across species

    • Structure-function relationships in membrane-associated proteins

    • Conservation and divergence of protein domains across phyla

  • Disease transmission implications:

    • Potential roles in pathogen-vector interactions

    • Contribution to vector competence mechanisms

    • Possible targets for transmission-blocking strategies

  • Basic membrane biology understanding:

    • Mechanisms of membrane microdomain organization

    • Protein-lipid interactions at biological membranes

    • Evolutionary adaptations in membrane proteins

By situating AAEL010189 research within these broader contexts, investigators can maximize the impact of their findings beyond the immediate focus on a single protein, contributing to both fundamental science and potential applications in disease control .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.