Recombinant Aedes aegypti Elongation of very long chain fatty acids protein AAEL008004 (AAEL008004)

Shipped with Ice Packs
In Stock

Description

Production and Purification

AAEL008004 is produced via recombinant DNA technology in E. coli:

ProcessDetailsSource
Expression HostE. coli
TaggingN-terminal His-tag for affinity purification
FormLyophilized powder or liquid (with glycerol for stability)
Purification MethodNickel affinity chromatography (implied by His-tag)

The protein is lyophilized to enhance stability, with reconstitution recommended in sterile water (0.1–1.0 mg/mL) supplemented with 5–50% glycerol for long-term storage .

Functional Insights

AAEL008004 is a key enzyme in fatty acid elongation, catalyzing the condensation of malonyl-CoA with acyl-CoA substrates to form elongated fatty acids. Its EC number (2.3.1.n8) reflects its role in transferring acyl groups from acyl-CoA to malonyl-CoA, generating 3-ketoacyl-CoA intermediates .

Pathways and Interactions

While specific pathway data for AAEL008004 is limited in available literature, fatty acid elongation is critical for:

  • Lipid membrane biosynthesis

  • Energy storage (e.g., triglycerides)

  • Signaling molecule production (e.g., eicosanoids)

No direct interactions with human receptors (e.g., CD4, DC-SIGN) have been reported for AAEL008004, unlike other Aedes aegypti salivary gland proteins .

Applications in Research

AAEL008004 serves as a tool for studying:

ApplicationDetailsSource
Fatty Acid ElongationInvestigating VLCFA biosynthesis in mosquitoes
Mosquito MetabolismUnderstanding lipid homeostasis in disease vectors
Drug TargetingExploring inhibitors of fatty acid elongation in mosquito development

Research Highlights

While no peer-reviewed studies directly involving AAEL008004 were identified in the provided sources, its role in fatty acid elongation aligns with broader research on:

  • Mosquito lipid metabolism: Critical for survival, reproduction, and pathogen transmission.

  • VLCFA biosynthesis: A potential target for disrupting mosquito development or vector competence.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, centrifuge the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize its implementation.
Synonyms
AAEL008004; Elongation of very long chain fatty acids protein AAEL008004; 3-keto acyl-CoA synthase AAEL008004; Very-long-chain 3-oxoacyl-CoA synthase AAEL008004
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
Target Names
AAEL008004
Target Protein Sequence
MALIMKYIDSMHHYMDKYGDPRTKDWPLMSSPFPTLALCLGYVYLVKVLGPRLMENRKPF QLRNTLILYNFVQVVFSAWLFYEIGISGWLTGHYNFRCQPVDYSNHPKTLRMVHACWWYY FSKFTEFFDTFFFVMRKKTSQVSTLHVIHHGCMPMSVWFGVKFTPGGHSTFFGLLNTFVH IVMYTYYLFTAMGPQFQKYLWWKKYLTSLQMVQFVAIMVHAFQLLFIDCNYPKAFVWWIG MHAVMFLFLFNEFYQSTYKATKRRRAAAAEARRLAAEEAKLQNGSAVSSNGSAITANGHH GKNGSVHHHSNGSATSNGTSLLSNGVGSNKAADYYVRGDLPAEIEITQRQPSSRNQVQ
Uniprot No.

Target Background

Function
This protein may be involved in the synthesis of very long chain fatty acids.
Database Links

STRING: 7159.AAEL008004-PA

UniGene: Aae.20776

Protein Families
ELO family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is AAEL008004 and what organism does it originate from?

AAEL008004 is an elongation of very long chain fatty acids protein that originates from Aedes aegypti, commonly known as the yellowfever mosquito (sometimes also referred to as Culex aegypti). This protein belongs to the broader family of fatty acid elongases that catalyze the first step in the elongation cycle of fatty acids. Structurally, AAEL008004 is a 358-amino acid protein with multiple transmembrane domains that localizes to the endoplasmic reticulum, similar to other elongases. The protein plays a crucial role in lipid metabolism within the mosquito, particularly in the elongation of fatty acid chains .

What is the predicted structural topology of AAEL008004?

Based on structural analysis of similar elongase proteins, particularly ELOVL4, there are two main predicted topological models for AAEL008004:

  • Five-transmembrane model: This model suggests that the protein spans the ER membrane five times, with specific functional domains distributed across these regions.

  • Seven-transmembrane model: More recent analyses suggest a seven-transmembrane spanning topology.

Both models place the active catalytic site on the cytoplasmic side of the ER membrane, which aligns with the protein's function in fatty acid elongation. This topology is critical for understanding the protein's interaction with its substrates (fatty acyl-CoAs and malonyl-CoA) and other elongation machinery proteins .

What are the primary biochemical functions of AAEL008004?

AAEL008004 functions primarily as a condensing enzyme in the fatty acid elongation cycle. It catalyzes the first and rate-limiting step in the elongation of fatty acids, specifically the condensation reaction between a fatty acyl-CoA and malonyl-CoA. This reaction adds two carbon atoms to the growing fatty acid chain.

The complete elongation process involves four sequential steps:

  • Condensation (catalyzed by elongases like AAEL008004)

  • Reduction (catalyzed by 3-ketoacyl-CoA reductase/KAR)

  • Dehydration (catalyzed by 3-hydroxyacyl-CoA dehydratases/HACD1-4)

  • A second reduction (catalyzed by trans-2,3-enoyl-CoA reductase/TER)

By comparison with the well-characterized ELOVL4, AAEL008004 likely has substrate specificity for certain chain lengths of fatty acids, leading to the production of very long-chain fatty acids (VLC-FAs) with 28 or more carbon atoms .

How does AAEL008004 relate to mammalian ELOVL enzymes?

While AAEL008004 is specifically from Aedes aegypti, it shares functional and structural similarities with mammalian ELOVL family proteins, particularly ELOVL4. Both are involved in the elongation of fatty acids to produce very long-chain fatty acids. Studies on mammalian ELOVL4 have shown that it mediates the elongation of long-chain polyunsaturated fatty acids (PUFA) and saturated fatty acids (SFA) to form VLC-PUFA and VLC-SFA, respectively.

The primary differences likely lie in their substrate specificity and the specific lengths of the products they generate. For example, mammalian ELOVL4 is known to produce VLC-FA with chain lengths up to 38 carbons, while the exact range for AAEL008004 needs further characterization. Understanding these comparative relationships is crucial for researchers studying lipid metabolism across different species .

What expression systems are recommended for producing recombinant AAEL008004?

For recombinant production of AAEL008004, E. coli has been successfully used as an expression host, as indicated by commercially available recombinant forms of the protein. When designing expression constructs, researchers should consider:

  • Codon optimization for the chosen expression system

  • Addition of appropriate tags (commonly His-tags) to facilitate purification

  • Proper signal sequences if necessary for membrane protein folding

The full-length protein (amino acids 1-358) has been successfully expressed with a His-tag, suggesting this approach is viable for research applications. For functional studies, mammalian or insect cell expression systems might better preserve the native conformation and activity of the protein, particularly since AAEL008004 is a multi-pass membrane protein that requires proper folding and insertion into membranes .

How should recombinant AAEL008004 be stored to maintain stability?

Based on available product information, the following storage recommendations apply to recombinant AAEL008004:

  • For liquid formulations:

    • Store at -20°C or -80°C

    • Expected shelf life of approximately 6 months

    • Use Tris-based buffer with 50% glycerol (optimized for protein stability)

  • For lyophilized formulations:

    • Store at -20°C or -80°C

    • Expected shelf life of approximately 12 months

    • Reconstitute only immediately before use

  • General handling recommendations:

    • Avoid repeated freeze-thaw cycles

    • For working solutions, store aliquots at 4°C for up to one week

    • Ensure sterile handling conditions to prevent contamination

These storage conditions help maintain the structural integrity and functional activity of the recombinant protein for research applications .

What techniques are available for studying AAEL008004 protein-protein interactions?

Several methodologies can be employed to study the protein-protein interactions of AAEL008004:

  • Co-immunoprecipitation (Co-IP):

    • Uses specific antibodies to precipitate AAEL008004 along with its binding partners

    • Requires development of specific antibodies or use of tagged recombinant proteins

    • Western blotting is used to identify co-precipitated proteins

  • Yeast Two-Hybrid (Y2H) screening:

    • Allows for identification of potential binding partners

    • Can be challenging for membrane proteins like AAEL008004

    • Modified membrane Y2H systems may be more appropriate

  • Pull-down assays:

    • Using recombinant tagged AAEL008004 to isolate interacting proteins

    • Mass spectrometry analysis of binding partners

    • Requires optimization of solubilization conditions for membrane proteins

  • Proximity labeling approaches (BioID or APEX2):

    • Fusion of biotin ligase to AAEL008004

    • In vivo labeling of proximal proteins

    • Particularly useful for membrane protein complexes

Based on studies of similar elongases, AAEL008004 likely forms homo-oligomeric complexes and hetero-oligomeric complexes with other elongation machinery components. These interactions are critical for understanding the protein's function in the elongation pathway .

What assays can be used to measure AAEL008004 elongase activity?

To measure the enzymatic activity of AAEL008004 as a fatty acid elongase, several assay methods can be employed:

  • Radiolabeled substrate incorporation:

    • Using [14C]-labeled malonyl-CoA or fatty acyl-CoA substrates

    • Measuring incorporation into elongated products

    • Analysis by thin-layer chromatography or HPLC

  • LC-MS/MS based assays:

    • Detection of specific elongated fatty acid products

    • Quantitative analysis of substrate-to-product conversion

    • High sensitivity for detecting changes in fatty acid profiles

  • Coupled enzyme assays:

    • Monitoring consumption of NADPH during the reduction steps

    • Spectrophotometric measurement at 340 nm

    • Requires purified additional elongation enzymes

  • In vitro reconstitution systems:

    • Incorporation of recombinant AAEL008004 into artificial membranes

    • Addition of other elongation machinery components

    • Analysis of complete elongation cycle

When designing these assays, it's important to consider the potential substrate specificity of AAEL008004. Based on studies of ELOVL4, potential substrates might include long-chain PUFA and SFA to form VLC-PUFA and VLC-SFA, with specific preference for certain chain lengths and degrees of saturation .

How can I design experiments to study AAEL008004 function in vivo?

For studying AAEL008004 function in vivo, several experimental approaches can be considered:

  • RNA interference (RNAi):

    • Design dsRNA or siRNA targeting AAEL008004

    • Delivery methods include microinjection or feeding

    • Monitor phenotypic effects and changes in fatty acid profiles

  • CRISPR/Cas9 gene editing:

    • Generation of knockout or knockdown mosquito lines

    • Analysis of developmental, physiological, and biochemical effects

    • Complementation studies to confirm specificity

  • Transgenic overexpression:

    • Create Aedes aegypti lines overexpressing wildtype or tagged AAEL008004

    • Analyze effects on fatty acid composition and related phenotypes

    • Study protein localization using fluorescently tagged constructs

  • Metabolic labeling studies:

    • Administer labeled fatty acid precursors

    • Track their incorporation into VLC-FA species

    • Compare between wildtype and AAEL008004-modified mosquitoes

  • Transcriptomic and lipidomic analyses:

    • Compare lipid profiles between control and AAEL008004-modified mosquitoes

    • Identify compensatory changes in gene expression

    • Map effects on downstream metabolic pathways

These approaches can help elucidate the physiological role of AAEL008004 in mosquito development, reproduction, and response to environmental challenges .

How might alternative splicing affect AAEL008004 function?

Alternative splicing can significantly impact AAEL008004 function by generating protein isoforms with potentially different properties:

  • Potential effects of alternative splicing:

    • Altered substrate specificity due to changes in the catalytic domain

    • Modified protein-protein interaction capabilities

    • Different subcellular localization if targeting signals are affected

    • Varied regulation through altered post-translational modification sites

  • Identifying alternative splicing events:

    • RNA-Seq analysis of different tissues and developmental stages

    • 3' RACE (Rapid Amplification of cDNA Ends) to identify different transcript isoforms

    • RT-PCR with isoform-specific primers

The 3' RACE technique is particularly valuable for identifying alternative polyadenylation events that might affect AAEL008004 expression. This method involves:

  • RNA extraction

  • Reverse transcription using oligo(dT) primers

  • PCR amplification with gene-specific and adapter primers

  • Nested PCR for increased specificity

  • Analysis of products by gel electrophoresis and sequencing

Studies of cold stress in insects have shown that alternative splicing and alternative polyadenylation can play important roles in adapting enzyme function to environmental conditions, which might also apply to AAEL008004 .

What is known about the oligomerization behavior of AAEL008004?

Based on studies of similar elongases, particularly ELOVL4, the following can be inferred about AAEL008004 oligomerization:

  • Homo-oligomerization:

    • AAEL008004 likely forms homodimers or higher-order oligomers

    • This oligomerization may be essential for normal enzymatic function

    • Disruption of dimerization could affect catalytic activity

  • Hetero-oligomerization:

    • AAEL008004 may form complexes with other components of the fatty acid elongation machinery

    • These complexes would include other enzymes involved in the four-step elongation cycle

    • The composition of these complexes might vary depending on the specific fatty acids being elongated

  • Structural determinants of oligomerization:

    • Transmembrane domains likely play key roles in protein-protein interactions

    • Specific motifs in the cytoplasmic domains may mediate complex formation

    • Lipid environment of the ER membrane may influence oligomerization state

  • Methods to study oligomerization:

    • Blue native PAGE to analyze native protein complexes

    • Cross-linking studies to capture transient interactions

    • FRET or BiFC assays for in vivo interaction monitoring

    • Size exclusion chromatography to determine complex size

Understanding the oligomerization behavior of AAEL008004 is crucial for interpreting its function in the elongation pathway and could provide insights into how its activity is regulated within the cellular context .

How does substrate specificity of AAEL008004 compare with other elongases?

The substrate specificity of AAEL008004 likely shares some characteristics with other elongases, particularly ELOVL4, but may have evolved specific preferences adapted to the mosquito lipid metabolism:

  • Predicted substrate preferences based on ELOVL4 studies:

    • Long-chain PUFA and SFA are likely substrates

    • Potential preference for certain chain lengths (e.g., C26-C28) as starting substrates

    • Possible elongation to produce VLC-FA up to C38

  • Experimental approaches to determine specificity:

    • In vitro assays with various fatty acyl-CoA substrates

    • Analysis of products by LC-MS/MS

    • Competition assays to determine relative preferences

    • Site-directed mutagenesis to identify residues involved in substrate recognition

  • Comparative analysis with other elongases:

    • Some elongases show narrow substrate specificity while others are more promiscuous

    • Sequence alignment with characterized elongases can predict specificity determinants

    • Phylogenetic analysis can reveal evolutionary relationships and functional divergence

  • Factors potentially influencing specificity:

    • Structural features of the substrate binding pocket

    • Specific amino acid residues in transmembrane domains

    • Interaction with other components of the elongation machinery

    • Lipid environment of the ER membrane

Understanding the substrate specificity of AAEL008004 is essential for predicting its physiological role in the mosquito and could potentially reveal unique features that distinguish it from mammalian elongases .

What challenges exist in studying AAEL008004 enzymatic activity?

Studying the enzymatic activity of AAEL008004 presents several technical challenges:

  • Membrane protein solubilization:

    • As a multi-pass membrane protein, AAEL008004 requires careful solubilization

    • Detergent selection is critical for maintaining native conformation

    • Lipid environment significantly impacts activity

  • Reconstitution of the complete elongation system:

    • AAEL008004 catalyzes only the first step in a four-enzyme process

    • Complete elongation requires additional enzymes (KAR, HACD, TER)

    • Coordinating the activities of multiple enzymes in vitro is technically challenging

  • Product detection limitations:

    • VLC-FA products may be present in low abundance

    • Specialized analytical methods required (high-sensitivity MS)

    • Distinguishing newly synthesized products from background lipids

  • In vivo complexity:

    • Redundancy with other elongases may mask phenotypes

    • Compensatory mechanisms can activate when one elongase is disrupted

    • Tissue-specific expression patterns complicate whole-organism studies

  • Experimental design considerations:

    • Controls for background elongase activity

    • Verification of proper protein folding and membrane insertion

    • Accounting for potential cofactor requirements

Researchers can address these challenges through careful experimental design, including the use of heterologous expression systems, reconstituted membrane systems, and sensitive analytical techniques for product detection .

How can ELOVL protein comparison inform AAEL008004 research?

Comparative analysis with well-characterized ELOVL proteins provides valuable insights for AAEL008004 research:

  • Structure-function relationships:

    • Mammalian ELOVL4 has been extensively studied, revealing critical functional domains

    • Transmembrane topology models (5-TM vs. 7-TM) derived from ELOVL studies can guide AAEL008004 structural investigation

    • Functional residues identified in ELOVL proteins can be mapped to AAEL008004 through sequence alignment

  • Substrate specificity patterns:

    • ELOVL4 mediates elongation of both PUFA and SFA to form VLC-FA

    • Preferred substrates include specific chain lengths (e.g., C26 for SFA elongation)

    • These patterns can inform substrate testing for AAEL008004

  • Disease-related insights:

    • Mutations in human ELOVL4 are associated with various disorders

    • Similar mutations could be introduced in AAEL008004 to study conserved mechanisms

    • The dominant-negative effect observed with mutant ELOVL4 may inform experimental approaches

  • Comparative table of ELOVL family characteristics:

ELOVL Family MemberPrimary SubstratesProduct Chain LengthKey Structural Features
ELOVL1Saturated and monounsaturated C18-C26Up to C28Forms complexes with ELOVL4
ELOVL3Saturated and monounsaturated C16-C22Up to C24Cold-inducible expression
ELOVL4VLC-PUFA and VLC-SFA of C28Up to C385-7 transmembrane domains
ELOVL6Saturated and monounsaturated C12-C16Up to C18Regulated by SREBP-1
AAEL008004 (predicted)Long-chain PUFA and SFALikely up to C28-C38Similar topology to ELOVL4

This comparative framework provides testable hypotheses about AAEL008004 function and guides experimental design for characterizing this mosquito elongase .

What are the optimal purification methods for recombinant AAEL008004?

Purification of recombinant AAEL008004 requires specialized approaches due to its nature as a multi-pass membrane protein:

  • Affinity purification strategies:

    • His-tagged versions have been successfully produced and can be purified using Ni-NTA affinity chromatography

    • Optimization of imidazole concentration for elution is critical to maximize purity

    • Multiple washing steps with increasing imidazole concentrations can improve purity

  • Membrane protein solubilization:

    • Gentle detergents like DDM, LMNG, or digitonin are recommended

    • Detergent screening is advisable to identify optimal conditions

    • Maintaining the cold chain throughout purification helps preserve activity

  • Secondary purification steps:

    • Size exclusion chromatography to separate monomeric and oligomeric forms

    • Ion exchange chromatography for further purification

    • Removal of aggregates through ultracentrifugation

  • Quality control assessments:

    • SDS-PAGE analysis to confirm purity (>85% purity has been achieved for commercial preparations)

    • Western blotting to verify identity

    • Circular dichroism to assess secondary structure

    • Thermal shift assays to evaluate stability

  • Considerations for activity preservation:

    • Addition of lipids or lipid-like molecules during purification

    • Inclusion of reducing agents to prevent oxidation of cysteine residues

    • Optimization of pH and ionic strength

These purification strategies should be tailored to the specific experimental requirements, with additional considerations if the protein will be used for structural studies or enzymatic assays .

How can 3' RACE be optimized for studying AAEL008004 transcript variants?

3' RACE (Rapid Amplification of cDNA Ends) is a valuable technique for identifying alternative polyadenylation and splice variants of AAEL008004. The following protocol elements are important for optimization:

  • RNA extraction and quality control:

    • Use RNase-free conditions throughout

    • Verify RNA integrity by gel electrophoresis or Bioanalyzer

    • Include DNase treatment to eliminate genomic DNA contamination

  • First-strand cDNA synthesis:

    • Use oligo(dT) primers with adapter sequences

    • PrimeScript Reverse Transcriptase has been successfully used

    • Reaction conditions: 42°C for 60 minutes, followed by 70°C for 15 minutes

  • PCR amplification strategy:

    • Design gene-specific primers based on known AAEL008004 sequence

    • Use a nested PCR approach for increased specificity:

      • Outer primer PCR: 94°C for 3 min, followed by 30 cycles at 94°C for 30s, 55°C for 30s, 72°C for 1 min, then 72°C for 10 min

      • Inner primer PCR: Same conditions, using the first PCR product as template

  • Product analysis:

    • Analyze products on 1.5% agarose gels

    • Purify bands of interest for sequencing

    • Clone products for detailed analysis of multiple variants

  • Validation of identified variants:

    • Design variant-specific primers for RT-PCR

    • Quantify relative abundance using qRT-PCR

    • Analyze expression patterns across tissues and conditions

This approach can reveal alternative polyadenylation sites and splice variants that might have functional significance for AAEL008004, particularly in response to environmental stressors like temperature changes .

What bioinformatic approaches can aid in analyzing AAEL008004 function?

Bioinformatic analyses provide valuable insights into AAEL008004 function without requiring extensive laboratory experiments:

  • Sequence-based analyses:

    • Multiple sequence alignment with characterized elongases to identify conserved domains

    • Phylogenetic analysis to place AAEL008004 within the evolutionary context of elongase families

    • Prediction of transmembrane domains using tools like TMHMM or Phobius

    • Identification of functional motifs and catalytic residues

  • Structure prediction:

    • Ab initio or homology modeling of protein structure

    • Docking simulations with potential substrates

    • Molecular dynamics simulations to study conformational changes

    • Prediction of protein-protein interaction interfaces

  • Expression analysis:

    • Mining transcriptomic datasets for AAEL008004 expression patterns

    • Identification of co-expressed genes to infer functional relationships

    • Analysis of promoter regions for regulatory elements

    • Investigation of tissue-specific expression patterns

  • Pathway analysis:

    • Integration of AAEL008004 into lipid metabolism pathways

    • GO (Gene Ontology) enrichment analysis

    • KEGG pathway mapping

    • Identification of potential metabolic networks involving AAEL008004

  • Software tools and databases:

    • WEGO software for GO categorization

    • BLAST for comparative sequence analysis

    • KEGG database for pathway annotation

    • MEME software for motif analysis of promoter regions

These bioinformatic approaches can guide experimental design and provide context for interpreting laboratory results, particularly in understanding how AAEL008004 compares to other elongases and how it fits into broader metabolic networks .

How does AAEL008004 function relate to mosquito physiology and vector biology?

The function of AAEL008004 in fatty acid elongation has potentially significant implications for mosquito physiology and vector biology:

  • Membrane composition and fluidity:

    • VLC-FAs are incorporated into membrane lipids

    • Membrane composition affects cellular functions and environmental adaptation

    • Changes in temperature or other stressors may require membrane lipid remodeling

  • Energy storage and metabolism:

    • Fatty acids serve as energy storage molecules

    • The elongation process affects the efficiency of energy storage

    • VLC-FAs may have specialized roles in energy metabolism

  • Reproduction and development:

    • Lipid metabolism is critical for egg production

    • Embryonic development requires specific fatty acid profiles

    • AAEL008004 may influence reproductive capacity and offspring viability

  • Environmental adaptation:

    • Cold tolerance in insects often involves lipid remodeling

    • Alternative splicing and polyadenylation of genes like AAEL008004 may be part of stress response mechanisms

    • Adaptation to various ecological niches may involve changes in VLC-FA metabolism

  • Vector competence:

    • Membrane composition can affect virus-host interactions

    • Lipid metabolism may influence pathogen development within the mosquito

    • AAEL008004 activity could potentially affect the mosquito's ability to transmit diseases

Understanding these connections can inform strategies for vector control and provide insights into mosquito adaptation to changing environments. Research in this area bridges basic biochemistry with applied vector biology .

What are key control experiments when studying AAEL008004?

When designing experiments to study AAEL008004, several critical controls should be included:

  • For recombinant protein expression:

    • Empty vector controls to account for background expression

    • Expression of a known functional elongase as a positive control

    • Verification of protein expression by Western blot before functional assays

    • Inclusion of a catalytically inactive mutant (e.g., site-directed mutagenesis of predicted catalytic residues)

  • For enzymatic activity assays:

    • No-enzyme controls to establish baseline measurements

    • Heat-inactivated enzyme controls to confirm enzymatic nature of the activity

    • Substrate-only and enzyme-only controls

    • Positive controls using characterized elongases with known activities

  • For in vivo studies:

    • Carefully matched control populations (age, sex, genetic background)

    • Sham treatments that mimic experimental manipulations

    • Phenotypic rescue experiments to confirm specificity of observed effects

    • Time course studies to capture developmental or temporal variation

  • For gene expression studies:

    • Multiple reference genes for normalization

    • No-template and no-RT controls for PCR

    • Validation of results using different detection methods

    • Sampling across multiple conditions and time points

  • For protein interaction studies:

    • Non-specific binding controls (e.g., IgG controls for immunoprecipitation)

    • Competition assays to demonstrate specificity

    • Reciprocal co-immunoprecipitation

    • Controls for membrane protein solubilization effects

These controls ensure that experimental results can be interpreted with confidence and that observed phenomena are specifically related to AAEL008004 rather than experimental artifacts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.