Recombinant Aedes aegypti Innexin shaking-B (shakB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Innexins are transmembrane proteins that form gap junctions in invertebrates, enabling direct electrical and metabolic coupling between cells . ShakB, a member of the innexin family, is expressed in Aedes aegypti tissues such as renal tubules and the ventral diverticulum, where it regulates ion exchange, nutrient transport, and contractile activity . The recombinant form is generated using heterologous expression systems (e.g., E. coli, yeast, or mammalian cells) to produce functional ShakB protein for experimental studies .

Key Features of Recombinant ShakB:

PropertyDetail
Molecular Weight44,510 Da (predicted)
Expression SystemsE. coli, yeast, baculovirus, or mammalian cells
Purity≥85% (verified by SDS-PAGE)
IsoformsLikely includes splice variants akin to Drosophila ShakB(N+16)

Functional Insights:

  • Electrical Synapses: ShakB forms rectifying gap junctions, enabling unidirectional current flow critical for neural circuits .

  • Renal Function: In mosquito renal tubules, ShakB facilitates ion transport and diuresis, which are disrupted by gap junction blockers like carbenoxolone .

  • Feeding Behavior: ShakB-mediated contractions in the ventral diverticulum regulate sugar storage and digestion .

Role in Neural and Muscular Systems

  • Electrical Coupling: ShakB is essential for synaptic transmission between neurons and muscles. In Drosophila, ShakB(N+16) presynaptic expression enables dye coupling and synapse formation . Misexpression alters gap junction distribution and synaptic strength .

  • Rectification: Heterotypic ShakB channels (e.g., ShakB(N+16) and ShakB(L)) exhibit voltage-dependent gating, enabling asymmetric current flow .

B. Physiological Roles in Aedes aegypti

  • Diuresis: ShakB knockdown reduces fluid secretion in renal tubules, highlighting its role in osmoregulation .

  • Ventral Diverticulum: Carbenoxolone inhibition of ShakB slows serotonin-induced contractions, impairing nutrient processing .

Applications in Research

Recombinant ShakB is used to:

  • Investigate mosquito physiology for vector control strategies.

  • Screen insecticides targeting gap junction function.

  • Study evolutionary conservation of innexin roles across species .

Technical Considerations

  • Antibodies: Rabbit anti-ShakB polyclonal antibodies enable detection in Western blot and ELISA .

  • Dye Coupling Assays: Neurobiotin tracer studies validate ShakB’s role in intercellular communication .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributor.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
shakB; AAEL014227; Innexin shaking-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-372
Protein Length
full length protein
Species
Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
Target Names
shakB
Target Protein Sequence
MLDIFRGLKNLVKISHVNTDSPVFRLHYSITVMILMAFSLIVTTKQYVGNPIDCVHTKDI PEEVLNTYCWIHSTYALKSLFLKKVGSEVPYPGVGNSDGKNIDKKIYKYYQWVCFCLFFQ AILFYTPRWLWKSWEGGKIHALMMDLDIGICSEIEKKQKKKLLLDYLWDNLRYHNWWAYR YYICEFLSLVNVIGQMFLMNRFFDGEFMTFGLDVITHMEADQEDRMDPMIYIFPRMTKCT FYKYGVSGEVERHDAICILPLNVVNEKIYIFLWFWFIILTILTTLTIFYRIIIIFSPRMR VYLLRLRFRLVRRDAIEIIVRRSKMGDWFLLYRLGENLDSIIFRDVMQDLANRLHNNQHH RVPGMKGEIQDA
Uniprot No.

Target Background

Function
Structural component of the gap junctions at electrical synapses in distal and mid-depth levels in the lamina.
Database Links

KEGG: aag:5579528

Protein Families
Pannexin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is Innexin shaking-B and what role does it play in Aedes aegypti mosquitoes?

Innexin shaking-B (shakB) is one of six innexin proteins (inx1, inx2, inx3, inx4, inx7, and inx8) found in Aedes aegypti mosquitoes . Innexins are invertebrate-specific proteins that form gap junction channels, which are intercellular channels allowing direct transfer of small molecules and ions between adjacent cells. These channels facilitate rapid coordination of cellular activities within tissues, which is particularly important during periods of extreme physiological change such as after blood feeding in female mosquitoes. In Aedes aegypti, shakB corresponds to inx8 and is involved in cell-to-cell communication networks essential for various physiological processes . Like other innexins, shakB has multiple transmembrane domains and conserved cysteine residues in the extracellular loops, which are critical for proper protein folding and function .

How can researchers verify the purity and identity of recombinant shakB protein?

For researchers working with recombinant Aedes aegypti Innexin shaking-B, verification of protein purity and identity should follow a multi-step approach:

  • SDS-PAGE analysis: Confirm protein purity is ≥85% as a standard benchmark for recombinant shakB .

  • Western blot: Utilize antibodies specific to shakB for immunological verification (anti-SHAKB polyclonal antibodies are available for this purpose) .

  • Mass spectrometry: Perform peptide mass fingerprinting to confirm protein identity.

  • Functional assays: Test gap junction formation capability in heterologous expression systems.

Researchers should document batch validation with standardized protocols including visualized gel documentation and quantitative purity assessments before proceeding to experimental applications.

What expression systems are suitable for producing recombinant Aedes aegypti shakB?

Multiple expression systems have been successfully employed for recombinant shakB production, each with distinct advantages for different research applications:

Expression SystemAdvantagesLimitationsBest Applications
Cell-Free ExpressionRapid production, avoids cell toxicity issues, allows production of difficult-to-express proteinsMay have lower yields, higher costStructural studies, high-throughput screening
E. coliHigh yield, cost-effective, well-established protocolsPotential folding issues, limited post-translational modificationsAntibody production, protein interaction studies
BaculovirusBetter post-translational modifications, suitable for complex proteinsMore complex setup, longer production timeFunctional studies requiring properly folded protein
Mammalian CellMost authentic post-translational modificationsHighest cost, lower yieldsStudies requiring native-like protein modifications

According to available commercial sources, recombinant Aedes aegypti shakB has been successfully produced using cell-free expression systems, which may indicate advantages for this particular protein .

How does shakB expression change after blood feeding in mosquitoes, and what experimental approaches best capture these dynamics?

Blood feeding in female Aedes aegypti mosquitoes triggers significant physiological changes, including potential alterations in innexin expression. While specific data on shakB (inx8) changes after blood meals is limited, studies on other innexins provide methodological insights:

Research has shown that at 24 hours post-blood meal (PBM), expression levels of inx2, inx3, and inx4 mRNAs increase significantly in Aedes aegypti, with tissue-specific patterns of upregulation . To effectively study shakB expression dynamics:

  • Temporal sampling: Collect samples at multiple timepoints (e.g., 3h, 24h, 48h PBM) to capture the full expression profile.

  • Tissue-specific analysis: Dissect and separately analyze midgut, ovaries, Malpighian tubules, and fat body, as innexin expression patterns vary by tissue .

  • qPCR validation: Use carefully designed primers specific to shakB with appropriate reference genes for normalization.

  • Protein-level confirmation: Complement mRNA studies with western blotting to verify translation effects.

The physiological relevance of these expression changes relates to the profound tissue transformations that occur post-blood meal, including midgut distension, digestive enzyme secretion, nutrient absorption, and vitellogenesis in ovaries .

What RNA interference (RNAi) approaches are most effective for functional studies of shakB in mosquitoes?

RNA interference represents a powerful approach for studying shakB function in Aedes aegypti. Based on protocols developed for other innexins, researchers should consider the following methodological recommendations:

  • dsRNA design: Target unique regions of shakB to avoid off-target effects on other innexins. Multiple non-overlapping dsRNAs should be tested to confirm specificity of phenotypes.

  • Delivery method: Microinjection of 1 μg dsRNA into the thorax of adult females has proven effective for innexin knockdown in mosquitoes .

  • Timing considerations: Allow 3 days post-injection before phenotypic analysis to achieve maximal knockdown (studies with inx2 showed 75-95% reduction in expression by this timepoint) .

  • Tissue-specific variation: Be aware that knockdown efficiency varies by tissue. For example, inx2 knockdown was found to be weaker in Malpighian tubules (44.9%) compared to midgut (94.8%), ovaries (88.5%), and fat body (91.0%) .

  • Controls: Include both uninjected controls and dsRNA targeting non-mosquito genes (e.g., eGFP) to control for injection effects .

  • Validation: Confirm knockdown by qPCR and assess potential compensatory upregulation of other innexins .

Researchers should note that phenotypic outcomes may be subtle. For example, knockdown of inx2 by more than 75% did not significantly affect fecundity in mosquitoes , suggesting potential functional redundancy among innexins.

How can electrophysiological approaches be adapted to study shakB-formed gap junction channels?

The study of gap junction channels formed by innexins requires specialized electrophysiological techniques. Drawing from research on Drosophila innexins:

  • Heterologous expression systems: The Xenopus oocyte paired expression system represents a powerful approach for studying innexin channel properties. This system allows for controlled expression of shakB alone or in combination with other innexins to study potential heteromeric channel formation .

  • Voltage-clamp protocols: Establish standard double voltage-clamp protocols to measure junctional conductance between paired cells. Start with voltage steps from -100 to +80 mV in 20 mV increments .

  • Assessment criteria:

    • Channel formation efficiency (percentage of cell pairs forming channels)

    • Voltage sensitivity characteristics

    • Unitary conductance measurements

    • Molecular permeability studies using dye transfer

Notably, studies with Drosophila innexins revealed that some innexins (like Dm-Inx3) cannot form functional channels alone but require co-expression with other innexins (like Dm-Inx2) . This suggests that shakB may similarly participate in heteromeric or heterotypic channels with distinct electrophysiological properties, warranting careful experimental design when studying its channel-forming properties.

How does Aedes aegypti shakB compare structurally and functionally to orthologs in other species?

Comparative analysis of shakB across species provides valuable evolutionary insights:

For shakB specifically, researchers should examine:

  • Sequence conservation: Compare sequence identity in key functional domains (transmembrane regions, cysteine-rich extracellular loops).

  • Expression patterns: Determine if the tissue-specific expression is conserved across species.

  • Functional complementation: Test if shakB from different species can substitute for each other in functional assays.

Understanding these cross-species similarities and differences can provide insights into the evolutionary constraints on innexin structure and function, potentially highlighting domains critical for channel formation versus species-specific regulatory regions.

What approaches can resolve contradictions in shakB functional data between different experimental systems?

Researchers often encounter contradictory results when studying innexin function across different experimental platforms. To resolve such inconsistencies:

  • Standardize protein expression levels: Varying expression levels can significantly impact channel formation efficiency and properties. Quantify protein expression using western blotting and standardize injection amounts in oocyte systems .

  • Consider protein interactions: Some innexins (like Drosophila Inx3) cannot form homotypic channels but function in heteromeric combinations . Test shakB in various combinations with other Aedes aegypti innexins.

  • Compare in vitro vs. in vivo results: Ectopic expression of individual innexins in Drosophila had limited effects on viability, but co-expression of complementary innexins severely reduced viability, presumably due to inappropriate gap junction formation . Similar approaches could resolve contradictions in shakB function.

  • Control for physiological state: Since innexin expression changes with physiological conditions (e.g., after blood feeding), ensure comparable physiological states when comparing results .

By systematically addressing these variables, researchers can build a more coherent understanding of shakB function across experimental systems.

What are the implications of shakB function for vector competence and disease transmission?

Understanding shakB function has potential implications for vector control strategies:

Gap junction communication mediated by innexins plays critical roles in coordinating physiological responses in tissues relevant to vector competence:

  • Midgut function: Since the midgut is the first barrier encountered by pathogens, shakB-mediated cell coordination may influence pathogen invasion success. After a blood meal, innexins including inx2, inx3, and inx4 show increased expression , suggesting a role in coordinating digestive and immune responses.

  • Immune system coordination: Cell-cell communication is crucial for mounting effective immune responses against invading pathogens.

  • Reproductive fitness: While inx2 knockdown did not affect fecundity in one study , other innexins may influence reproductive success, and shakB could potentially play redundant roles.

Research approaches should include:

  • Studying shakB expression changes upon pathogen infection

  • Examining how shakB knockdown affects pathogen development and transmission

  • Investigating physiological coordination between tissues during the infection process

Understanding these mechanisms could potentially identify new targets for blocking disease transmission by disrupting essential cell-cell communication pathways.

How can structural information about shakB be utilized to design gap junction modulators for research applications?

Developing tools to selectively modulate gap junction function would advance both basic research and potential applied interventions:

  • Key structural features to target:

    • Conserved cysteine residues in extracellular loops that are critical for docking between hemichannels

    • Transmembrane domains forming the channel pore

    • Cytoplasmic regulatory domains controlling channel gating

  • Research approaches:

    • Homology modeling based on available innexin structures

    • Molecular dynamics simulations to identify small molecule binding sites

    • Peptide mimetics targeting extracellular loop interactions

    • In silico screening followed by functional validation

  • Validation strategies:

    • Electrophysiological assays in Xenopus oocytes expressing shakB

    • Dye transfer studies in cultured cells

    • Ex vivo tissue preparations from mosquitoes

Development of specific modulators would enable precise temporal control of gap junction function, complementing genetic approaches that typically affect protein expression over longer timescales.

What emerging technologies could advance shakB research beyond current methodological limitations?

Several cutting-edge technologies hold promise for addressing current limitations in shakB research:

  • CRISPR-Cas9 genome editing: Development of precise gene editing in Aedes aegypti enables:

    • Creation of shakB reporter lines (fluorescent protein fusions)

    • Conditional knockdown systems for tissue-specific functional analysis

    • Introduction of single amino acid mutations to study structure-function relationships

  • Single-cell transcriptomics: Application to blood-fed versus non-blood-fed mosquitoes would reveal:

    • Cell-type specific expression patterns of shakB

    • Co-expression networks identifying potential interacting partners

    • Temporal dynamics at higher resolution than tissue-level studies

  • Cryo-EM structural analysis: Determination of shakB channel structure would enable:

    • Visualization of homotypic versus heterotypic channel configurations

    • Identification of critical residues for selective permeability

    • Structure-based design of specific channel modulators

  • Optogenetic approaches: Development of light-controlled innexin variants would allow:

    • Temporal control of gap junction function in specific tissues

    • Real-time observation of physiological consequences of channel opening/closing

    • Dissection of signaling pathways dependent on gap junctional communication

Integration of these technologies would provide unprecedented insights into shakB function in mosquito physiology and potential applications in vector control strategies.

How might systems biology approaches integrate shakB function into broader cellular communication networks in mosquitoes?

Understanding shakB in the context of broader cellular networks requires integrative approaches:

  • Multi-omics integration strategies:

    • Combine transcriptomics, proteomics, and metabolomics data from the same physiological states

    • Map changes in shakB expression to alterations in metabolite transfer between cells

    • Identify regulatory networks controlling innexin expression after blood feeding

  • Network modeling approaches:

    • Develop computational models of tissue-specific gap junction networks

    • Simulate effects of channel composition on intercellular molecule diffusion

    • Predict systemic consequences of shakB disruption

  • Research questions addressable through systems approaches:

    • How does the pattern of innexin expression determine the "connectivity map" of different tissues?

    • What metabolites and signaling molecules primarily depend on shakB-containing channels for intercellular transfer?

    • How do changes in gap junction composition after blood feeding reconfigure tissue coordination for egg production and pathogen defense?

This systems-level understanding would place shakB in its proper physiological context, potentially revealing unexpected roles in mosquito biology and identifying novel intervention points for vector control.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.