Recombinant Aedes aegypti V-type proton ATPase 16 kDa proteolipid subunit (AAEL000291)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Structure

The AAEL000291 gene encodes the 16 kDa proteolipid subunit of the V-ATPase, a multisubunit proton pump. The recombinant form (UniProt ID: O16110) is expressed in E. coli with an N-terminal His-tag for purification . Key structural features include:

  • Amino Acid Sequence: A 157-residue protein with conserved transmembrane domains critical for proton channel formation .

  • Domains: Four transmembrane helices (residues 11–33, 56–76, 93–114, 132–152) .

  • Molecular Weight: ~16 kDa (theoretical: 15.7 kDa) .

Functional Role in Mosquito Physiology

The V-ATPase generates proton gradients across membranes, enabling:

  • Organelle Acidification: Critical for lysosomal function, protein degradation, and synaptic vesicle proton gradients .

  • Secondary Transport: Powers nutrient uptake (e.g., potassium ions in Malpighian tubules) via electrochemical coupling .

  • Viral Interactions: Modulates CHIKV and DENV infection by influencing endosomal pH and vesicular trafficking .

In Ae. aegypti, this subunit is implicated in midgut and salivary gland function, where V-ATPase activity supports blood meal digestion and ionoregulation . Proteomic studies reveal its involvement in oxidative phosphorylation and ribosome biogenesis during CHIKV infection .

Mechanistic Studies

  • Viral Pathogenesis: Used to investigate how V-ATPase inhibition affects arbovirus replication (e.g., Zika, dengue) .

  • Ion Transport: Functional assays in insect epithelia quantify proton-pumping efficiency under physiological stressors .

Therapeutic Development

  • Drug Screening: Serves as a target for small-molecule inhibitors to disrupt mosquito-borne virus transmission .

  • Vaccine Research: Antigenic characterization to develop transmission-blocking vaccines .

Table 2: Recombinant Protein Production Details

ParameterSpecification
Cloning VectorpET-based plasmid
Host StrainE. coli BL21(DE3)
SolubilityInsoluble inclusion bodies (requires refolding)
Reconstitution0.1–1.0 mg/mL in deionized water with 50% glycerol for stability

Mass spectrometry (timsTOF Pro) and label-free quantification confirm identity and post-translational modifications .

Key Research Findings

  • Proteomic Regulation: CHIKV infection suppresses AAEL000291 expression at 24–48 hpi, correlating with attenuated oxidative phosphorylation .

  • Genetic Knockdown: Silencing AAEL000291 in Ae. aegypti reduces midgut acidification, impairing DENV-2 infection .

  • Evolutionary Conservation: Structural homology with human ATP6V0C (82% similarity) enables cross-species functional studies .

Future Directions

  • Cryo-EM Studies: Resolve conformational changes during proton translocation .

  • Field Trials: Assess inhibitors in mosquito populations to curb arbovirus transmission .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
AAEL000291; V-type proton ATPase 16 kDa proteolipid subunit; V-ATPase 16 kDa proteolipid subunit; V-ATPase subunit C; Vacuolar proton pump 16 kDa proteolipid subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
Target Names
AAEL000291
Target Protein Sequence
MALPEENPVYGPFFGVMGAAAAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVV MAGIIAIYGLVVAVLIAGSLDTPTKYSLYKGFIHLGAGLAVGFSGLAAGFAIGIVGDAGV RGTAQQPRLFVGMILILIFAEVLGLYGLIVAIYLYTK
Uniprot No.

Target Background

Function
This protein is the proton-conducting pore-forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying various intracellular compartments in eukaryotic cells.
Database Links

KEGG: aag:5573732

STRING: 7159.AAEL000291-PA

UniGene: Aae.4555

Protein Families
V-ATPase proteolipid subunit family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

What is the molecular architecture of the V-type proton ATPase in Aedes aegypti?

The V-type proton ATPase (V-ATPase) in A. aegypti, like in other organisms, consists of two major sectors: the membrane-integral V₀ domain (responsible for proton translocation) and the cytosolic V₁ domain (responsible for ATP hydrolysis). The 16 kDa proteolipid subunit (AAEL000291) forms part of the V₀ domain's proteolipid ring, which is crucial for proton transport .

The complete V-ATPase complex consists of:

DomainSubunits
V₀ (membrane)Subunits a, c, c", d, e
V₁ (cytosolic)Subunits A through H

The proteolipid ring in V₀ was initially thought to contain six proteolipids, but recent research in yeast and mammals suggests it contains ten proteolipids with conserved glutamic acid residues that serve as proton-binding sites in a flexible transmembrane helix .

How does AAEL000291 expression vary throughout Aedes aegypti development?

RNA-Seq comparisons between larval and adult Malpighian tubules show significant developmental regulation of V-ATPase subunits. While specific data for AAEL000291 shows moderate expression levels (1.2 ± 0.1) in 9 out of 12 samples analyzed, many V-ATPase subunits demonstrate higher expression in larval stages compared to adults .

Comparative expression data from Malpighian tubules:

ProteinGene IDAdult/Larval Fold ChangeP-value
V-ATPase catalytic subunit AAAEL0087870.34 (2.96× higher in larvae)<0.001
V-type proton ATPase 16 kDa proteolipid subunitAAEL010139Variable (16.9 ± 28.8)Not reported
Vacuolar ATP synthase subunit HAAEL000291Moderate (1.2 ± 0.1)Not reported

This developmental regulation may reflect the changing osmoregulatory needs throughout the mosquito lifecycle .

What methods are most effective for recombinant expression of AAEL000291?

For successful recombinant expression of AAEL000291, a multi-step approach is recommended:

  • Expression system selection: E. coli systems often yield inclusion bodies requiring refolding. For functional studies, insect cell systems (Sf9, High Five) are preferred as they provide proper post-translational modifications and membrane insertion.

  • Construct design:

    • Include a cleavable N-terminal tag (His₆ or Strep-tag II) for purification

    • Consider a fusion protein approach (MBP or SUMO) to enhance solubility

    • Include TEV protease sites for tag removal post-purification

  • Expression optimization:

    • For bacterial expression: Use C41(DE3) or C43(DE3) strains designed for membrane proteins

    • For insect cells: Optimize infection MOI and harvest time (typically 48-72 hours post-infection)

    • Maintain temperature at 18-20°C during induction to minimize aggregation

  • Functional verification: Reconstitute purified protein into proteoliposomes to verify proton transport activity using methods similar to those described for V-ATPase activity assessment in isolated membrane vesicles .

How can I measure V-ATPase activity in Aedes aegypti tissues?

V-ATPase activity can be measured through several complementary approaches:

  • ATP hydrolysis assay: Use an enzymatic coupled assay where ATP hydrolysis is linked to NADH oxidation, measured as a decrease in absorbance at 340 nm. V-ATPase-specific activity is determined by the sensitivity to 100 nM concanamycin A (a specific V-ATPase inhibitor) .

  • Proton transport assay: Measure ATP-dependent proton transport in purified vacuolar membrane vesicles using pH-sensitive fluorescent dyes like ACMA (9-amino-6-chloro-2-methoxyacridine) or pyranine.

  • Membrane fractionation protocol:

    • Homogenize tissues in buffer containing 250 mM sucrose, 10 mM HEPES, 1 mM EDTA, pH 7.5

    • Perform differential centrifugation (1,000g → 10,000g → 100,000g)

    • Purify vacuolar membranes using Ficoll density gradient centrifugation

    • Verify enrichment by Western blotting using antibodies against the V₁A subunit

FractionV-ATPase Activity (μmol ATP/min/mg)Concanamycin A-Sensitive Activity (%)
Crude homogenate0.5-1.020-30
Vacuolar membranes3.0-5.070-90

How does the V-ATPase proteolipid subunit contribute to ion transport in mosquito tissues?

In Malpighian tubules of A. aegypti, the V-ATPase provides the primary energetic drive for both transcellular and paracellular ion transport . The proteolipid subunit is critical to this function as it forms the actual proton channel through the membrane.

The physiological role involves:

  • Primary active transport: V-ATPase establishes an electrochemical proton gradient across the apical membrane of principal cells in Malpighian tubules.

  • Secondary transport: This gradient drives secondary ion transport processes including:

    • Na⁺/H⁺ exchange via NHA transporters (particularly upregulated in larvae)

    • K⁺ transport via Kir channels (with developmental regulation - Kir1 upregulated in adults, Kir3 in larvae)

    • Cl⁻ transport through channels and transporters

  • Systemic integration: The V-ATPase-driven ion transport in Malpighian tubules coordinates with neuroendocrine signals to maintain hemolymph homeostasis in response to blood-feeding and environmental challenges .

What structural features distinguish AAEL000291 from other proteolipid subunits?

The AAEL000291 protein contains several distinctive structural elements compared to homologs in other species:

  • Conserved glutamic acid residue: Like all V-ATPase proteolipid subunits, AAEL000291 contains a critical conserved glutamic acid residue in the fourth transmembrane helix that serves as the proton-binding site.

  • Transmembrane topology: The protein features four transmembrane α-helices with both N- and C-termini facing the cytoplasmic side.

  • Species-specific variations: Sequence alignment with proteolipid subunits from other insects reveals higher conservation in the transmembrane domains than in the connecting loops, suggesting functional constraints on the membrane-spanning regions.

  • Post-translational modifications: Multiple phosphorylation sites have been identified, particularly on serine and threonine residues in the cytoplasmic loops, which may regulate assembly or activity .

What are the optimal protocols for subcellular localization studies of AAEL000291?

For effective subcellular localization studies:

  • Immunofluorescence microscopy:

    • Fix tissues in 4% paraformaldehyde

    • Permeabilize with 0.1% Triton X-100

    • Block with 3% BSA

    • Incubate with primary antibodies against AAEL000291 (1:1000 dilution)

    • Detect with fluorescent secondary antibodies (1:500)

    • Counterstain with DAPI for nuclei and phalloidin for F-actin

    • Image using confocal microscopy

  • Subcellular fractionation:

    • Separate membrane fractions by differential centrifugation

    • Analyze protein distribution by Western blotting

    • Use markers for different compartments: Na⁺/K⁺-ATPase (plasma membrane), calnexin (ER), GM130 (Golgi)

  • Electron microscopy:

    • Process tissues for transmission electron microscopy

    • Perform immunogold labeling using antibodies against AAEL000291

    • Quantify gold particle distribution across different membrane compartments

How can I design effective RNAi experiments targeting AAEL000291?

For effective RNAi-mediated knockdown:

  • dsRNA design:

    • Target a 300-500 bp region specific to AAEL000291

    • Avoid regions with sequence similarity to other genes

    • Design using E-RNAi or DEQOR software to minimize off-target effects

    • Include dsRNA targeting GFP or LacZ as negative controls

  • Delivery methods:

    • Microinjection: Inject 500-1000 ng dsRNA into the thorax of adult female mosquitoes

    • Feeding: Mix dsRNA with blood meal (10 μg/ml) supplemented with a transfection reagent

    • Cell culture: Transfect A. aegypti-derived cells (Aag2) with dsRNA using Lipofectamine

  • Validation of knockdown:

    • Measure AAEL000291 mRNA levels by RT-qPCR 3-5 days post-treatment

    • Assess protein reduction by Western blotting

    • Evaluate functional consequences by measuring V-ATPase activity

Delivery MethodKnockdown Efficiency (%)Duration of Effect (days)Technical Difficulty
Microinjection70-907-10High
Feeding40-603-5Low
Cell culture80-952-4Medium

How can I resolve contradictory expression data for AAEL000291 across different studies?

When facing contradictory expression data:

  • Methodological comparison:

    • Compare RNA extraction and quality assessment methods

    • Evaluate normalization strategies (housekeeping genes vs. global normalization)

    • Assess technical vs. biological replication

  • Biological variables to consider:

    • Mosquito strain differences (laboratory vs. field-collected)

    • Developmental stage precision (hours post-eclosion matters)

    • Blood-feeding status (significant transcriptional changes occur post-blood meal)

    • Sex differences (male vs. female expression patterns)

    • Tissue-specific expression patterns

  • Integrated analysis approach:

    • Combine RNA-Seq, microarray, and RT-qPCR data

    • Weight results based on methodological rigor

    • Consider meta-analysis approaches for multiple datasets

    • Validate key findings with independent biological samples

Studies have shown considerable variation in V-ATPase subunit expression between developmental stages, with the catalytic subunit A showing 2.96× higher expression in larvae compared to adults , which could explain some contradictory findings if developmental staging was imprecise.

What bioinformatic approaches are most effective for studying the evolution of AAEL000291?

For evolutionary analysis of AAEL000291:

  • Sequence-based approaches:

    • Multiple sequence alignment using MUSCLE or MAFFT

    • Phylogenetic tree construction using maximum likelihood (RAxML or IQ-TREE)

    • Selection analysis using PAML to identify sites under positive or purifying selection

    • Ancestral sequence reconstruction to trace the evolution of key residues

  • Structure-based analyses:

    • Homology modeling based on existing V-ATPase structures

    • Molecular dynamics simulations to assess functional impacts of evolutionary changes

    • Protein-protein interaction interface analysis across species

  • Comparative genomics:

    • Synteny analysis to examine gene order conservation

    • Analysis of selection pressures using dN/dS ratios

    • Investigation of gene duplication events in the V-ATPase family

  • Population genomics:

    • Analysis of single nucleotide polymorphisms in AAEL000291 across A. aegypti populations

    • Assessment of geographic variation and adaptive evolution

    • Correlation with insecticide resistance or vector competence phenotypes

How does V-ATPase function relate to vector competence in Aedes aegypti?

The relationship between V-ATPase function and vector competence involves several mechanisms:

  • pH regulation during viral infection:

    • V-ATPase activity modulates endosomal pH, which is critical for dengue virus fusion and entry

    • Transcriptomic data shows differential expression of V-ATPase subunits in dengue-infected mosquitoes compared to uninfected controls

    • Several genes associated with proteolysis (including some regulated by pH) show significant differences between infected and uninfected mosquitoes

  • Immune response modulation:

    • V-ATPase-dependent acidification impacts immune signaling pathways

    • Dengue-infected mosquitoes show differential expression of chromatin-associated genes, proteases, and immunity-related factors that may interact with V-ATPase function

    • Specific immunity-related transcripts like CTLMA12, cathepsin B, and holotricin show increased abundance in dengue-infected mosquitoes

  • Tissue-specific implications:

    • Midgut V-ATPase function influences the initial steps of viral infection

    • Salivary gland V-ATPase activity may impact viral transmission

    • Malpighian tubule V-ATPase affects systemic homeostasis during infection

What are the emerging technologies for studying the dynamics of V-ATPase assembly in vivo?

Cutting-edge approaches for studying V-ATPase dynamics include:

  • Real-time imaging techniques:

    • FRET-based biosensors to monitor V-ATPase subunit interactions

    • pH-sensitive GFP variants to visualize compartment acidification in real-time

    • Photoactivatable and photoconvertible fluorescent proteins to track subunit movement

  • Cryo-electron microscopy:

    • Single-particle cryo-EM to determine high-resolution structures of different assembly states

    • Cryo-electron tomography of cellular sections to visualize V-ATPase in its native environment

    • Time-resolved cryo-EM to capture intermediate assembly states

  • Mass spectrometry approaches:

    • Crosslinking mass spectrometry to map subunit interfaces

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

    • Quantitative proteomics to measure assembly/disassembly kinetics

  • Genetic approaches:

    • CRISPR-Cas9 genome editing to create tagged V-ATPase subunits at endogenous loci

    • Optogenetic tools to control V-ATPase assembly/disassembly

    • Single-cell transcriptomics to identify cell-specific regulation patterns

These technologies provide unprecedented insights into the dynamic regulation of V-ATPase assembly and disassembly in response to environmental cues and developmental signals.

What strategies can overcome difficulties in purifying functional recombinant AAEL000291?

When facing purification challenges:

  • Solubilization optimization:

    • Test different detergents (DDM, LMNG, GDN) at various concentrations

    • Include lipids (cholesterol, POPC) during solubilization

    • Use mild extraction conditions (lower temperature, gentler agitation)

  • Purification refinements:

    • Implement gradient elution protocols to improve separation

    • Add stabilizing agents (glycerol, specific lipids) to all buffers

    • Consider amphipol or nanodisc reconstitution for increased stability

    • Use size-exclusion chromatography as a final polishing step

  • Functional assessment:

    • Develop sensitive activity assays compatible with detergent-solubilized protein

    • Implement reconstitution into proteoliposomes for functional studies

    • Use thermal stability assays to identify optimal buffer conditions

  • Co-expression strategies:

    • Express AAEL000291 together with other V₀ subunits to improve folding

    • Consider co-expression with chaperones to enhance proper membrane insertion

    • Develop a strategy similar to that used for Vacuolar ATP synthase subunit H purification

How can I differentiate between direct and indirect effects when studying AAEL000291 function?

To distinguish direct from indirect effects:

  • Complementary approaches:

    • Combine genetic knockdown with rescue experiments using RNAi-resistant constructs

    • Use pharmacological inhibitors with different mechanisms of action

    • Employ rapid inducible systems to observe immediate vs. delayed effects

  • Biochemical validation:

    • Perform in vitro reconstitution with purified components

    • Use site-directed mutagenesis to create separation-of-function mutants

    • Conduct interaction studies with purified proteins to verify direct associations

  • Temporal analysis:

    • Implement time-course experiments to establish sequence of events

    • Use rapid inhibition techniques (photocaged inhibitors, optogenetics)

    • Correlate phenotypic changes with molecular events using synchronized assays

  • System-level integration:

    • Develop mathematical models to predict direct vs. network effects

    • Use multi-omics approaches to identify immediate targets and downstream effects

    • Compare effects across different cellular contexts and genetic backgrounds

These strategies enable more precise attribution of observed phenotypes to direct AAEL000291 function versus secondary cellular responses.

Comparative expression of V-ATPase components in Aedes aegypti tissues

SubunitGene IDMalpighian Tubules (FPKM)Midgut (FPKM)Salivary Glands (FPKM)
V-ATPase subunit HAAEL0002911.2 ± 0.1Not reportedNot reported
V-type proton ATPase 16 kDa proteolipidAAEL01013916.9 ± 28.8Not reportedNot reported
Catalytic subunit AAAEL008787Larval: ~3× higher than adultVariableVariable

Key residues in AAEL000291 and their functional significance

ResidueConservationFunctionEffect of Mutation
Glu139*UniversalProton bindingLoss of proton transport
Arg59*HighStabilizes helix packingImpaired assembly
Ser22*ModeratePhosphorylation siteAltered regulation
Gly34*HighHelix flexibilityRigid structure, impaired rotation

*Hypothetical positions based on conserved features of V-ATPase proteolipid subunits

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.