Recombinant Aedes albopictus ATP synthase subunit a (mt:ATPase6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for the specific delivery time.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mt:ATPase6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta)
Target Names
mt:ATPase6
Target Protein Sequence
MMTNLFSVFDPSTTIFNMSLNWFSTFIGLLIIPSTFWLMPNRFQIIWNNILLTLHKEFKT LLGPNGHNGSTLMFVSLFSLIMFNNFLGLFPYIFTSTSHLTLTLTLAFPLWLSFMLYGWI CHTQHMFAHLVPQGTPPMLMPFMVCIKTISNVIRPGTLAVRLTANMIAGHLLMTLLGNTG PMSTSYIILSMILITQIALLVLESAVAIIQSYVFAVLSTLYSSEVN
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) is responsible for producing ATP from ADP in the presence of a proton gradient across the membrane. This gradient is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel, linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation via a rotary mechanism of the central stalk subunits. The ATP synthase subunit a is a key component of the proton channel and may play a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit a (mt:ATPase6) and what is its function in Aedes albopictus?

ATP synthase subunit a (mt:ATPase6) is a critical component of the mitochondrial F-type ATP synthase complex in Aedes albopictus. This protein is encoded by the mitochondrial genome and forms part of the F₀ sector, which is responsible for proton translocation across the inner mitochondrial membrane. The F₀ sector couples proton movement to the rotary motion of the enzyme, ultimately driving ATP synthesis in the F₁ sector .

The mt:ATPase6 protein in A. albopictus consists of 226 amino acids and functions as part of the multisubunit nanomotor that maintains cellular ATP levels. As a key component of the proton channel, it facilitates the conversion of the proton motive force into mechanical energy that drives the conformational changes needed for ATP synthesis .

What is the significance of studying recombinant mt:ATPase6 in vector mosquito research?

Studying recombinant mt:ATPase6 in vector mosquitoes like Aedes albopictus has several significant implications:

  • Vector control strategy development: As a critical component of energy metabolism, understanding mt:ATPase6 function could reveal potential targets for novel insecticides. Disruption of ATP synthesis could provide effective mosquito control mechanisms with potentially limited impacts on non-target organisms due to sequence divergence .

  • Physiological adaptation insights: Research on mt:ATPase6 can illuminate how energy metabolism changes during key life processes like blood feeding. Transcriptomic evidence has shown dramatic functional transitions in mosquito tissues after blood feeding, with changes in oxidative metabolism and ATP synthesis pathways .

  • Evolutionary biology: The divergent nature of F₀ subunits across species can provide insights into the evolutionary history of different insect lineages and the adaptation of energy metabolism to different ecological niches .

  • Reference for comparative studies: Recombinant protein characterization provides a standard reference for comparing native protein function across different physiological states and different mosquito species .

What expression systems are most effective for producing recombinant Aedes albopictus mt:ATPase6?

The most widely documented expression system for producing recombinant Aedes albopictus mt:ATPase6 is Escherichia coli. The commercially available recombinant protein (UniProt ID: Q5JCK5) spanning the full length (amino acids 1-226) is successfully expressed in E. coli with an N-terminal His tag .

When selecting an expression system for mt:ATPase6, researchers should consider:

What purification strategies yield the highest purity and activity for recombinant mt:ATPase6?

Purification of recombinant Aedes albopictus mt:ATPase6 typically employs affinity chromatography approaches, leveraging the N-terminal His tag for selective purification. A multi-step purification protocol is recommended to achieve >90% purity as determined by SDS-PAGE :

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin efficiently captures His-tagged mt:ATPase6 from clarified cell lysates.

  • Buffer conditions: Optimized buffer conditions should include mild detergents (e.g., 0.1% Triton X-100 or n-dodecyl β-D-maltoside) to maintain protein solubility without denaturing the hydrophobic regions.

  • Secondary purification: Size exclusion chromatography as a polishing step can separate monomeric protein from aggregates and impurities.

  • Quality control: Final purity should be assessed by SDS-PAGE and Western blotting using anti-His antibodies or specific antibodies against mt:ATPase6.

For storage, the purified protein can be maintained in Tris/PBS-based buffer with 6% trehalose at pH 8.0. The addition of 5-50% glycerol is recommended for long-term storage at -20°C/-80°C, with a default recommendation of 50% glycerol final concentration .

How can researchers assess the structural integrity and functional activity of purified recombinant mt:ATPase6?

Assessing the structural integrity and functional activity of purified recombinant mt:ATPase6 requires multiple analytical approaches:

Structural Integrity Assessment:

  • Circular Dichroism (CD) Spectroscopy: To analyze secondary structure content and proper folding of the recombinant protein.

  • Limited Proteolysis: To verify the proper folding of domains, as properly folded proteins often show resistance to proteolytic digestion at specific sites.

  • Intrinsic Fluorescence Spectroscopy: To examine tertiary structure through monitoring the fluorescence of aromatic residues in different environments.

Functional Activity Assessment:

  • Reconstitution into Liposomes: The purified protein can be reconstituted into liposomes to measure proton translocation activity using pH-sensitive fluorescent dyes.

  • ATP Synthesis Assays: When combined with other ATP synthase components, the reconstituted complex can be assessed for ATP synthesis activity using luciferase-based ATP detection methods.

  • Proton Gradient Formation: Measuring the ability to form or maintain a proton gradient across a membrane.

For comprehensive characterization, researchers should combine these approaches with control experiments using known inhibitors of ATP synthase function, such as oligomycin, to confirm specificity of the observed activities .

How does mt:ATPase6 expression change during the mosquito life cycle and after blood feeding?

Research on mosquito physiology has revealed significant changes in ATP synthase expression throughout the life cycle and particularly after blood feeding. Transcriptomic analysis of Malpighian tubules in Aedes albopictus has documented a coordinated down-regulation of nearly all subunits of V-type H+-ATPase after blood feeding .

While this study focused primarily on V-type ATPases rather than F-type ATP synthases, the findings suggest a broader metabolic reprogramming that likely affects mitochondrial ATP synthase as well. This metabolic shift appears to represent a functional transition of the tubule epithelium from active transepithelial fluid secretion to detoxification and metabolic waste excretion .

The temporal pattern of these changes follows:

Time Point After Blood FeedingObserved Changes in ATP Synthase-Related Transcripts
3 hoursInitial down-regulation of transcripts associated with oxidative metabolism and ATP synthesis
12 hoursProgressive decrease in expression of transcripts related to active transport
24 hoursSignificant reduction in oxidative phosphorylation/ATP synthesis cluster transcripts

This temporal pattern correlates with the physiological transition from handling the osmotic challenges of blood feeding to processing the metabolic waste associated with blood digestion .

What site-directed mutagenesis approaches can be used to investigate structure-function relationships in mt:ATPase6?

Site-directed mutagenesis of recombinant mt:ATPase6 can provide valuable insights into structure-function relationships of this important protein. Based on established approaches in ATP synthase research, the following mutagenesis strategies are recommended:

  • Mutation of Conserved Residues in Proton Channels:

    • Identify conserved residues likely involved in proton translocation (typically acidic residues in transmembrane regions)

    • Generate alanine substitutions to assess changes in proton conductance

    • Create charge-reversal mutations to examine electrostatic requirements

  • Subunit Interface Mutations:

    • Target residues at predicted interfaces with other F₀ subunits

    • Generate mutations that alter hydrophobicity, charge, or steric properties

    • Assess impacts on subunit assembly and complex stability

  • Transmembrane Domain Modifications:

    • Introduce mutations that alter the hydrophobicity or length of transmembrane helices

    • Examine effects on membrane insertion and protein stability

    • Use cysteine-scanning mutagenesis to map accessibility of different regions

For effective execution of these approaches, researchers should:

  • Use recombinant expression systems that permit rapid screening of mutants

  • Develop functional assays that can detect subtle changes in activity

  • Combine mutagenesis with structural modeling based on more well-characterized ATP synthase complexes from other species

How can recombinant mt:ATPase6 be used in the development of novel mosquito control agents?

Recombinant mt:ATPase6 offers several strategic approaches for developing novel mosquito control agents:

  • High-throughput Screening Platform:

    • Purified recombinant mt:ATPase6 can serve as a target for screening chemical libraries

    • Compounds that specifically bind to or inhibit mt:ATPase6 function can be identified

    • Differential screening against human ATP synthase components can identify mosquito-specific inhibitors

  • Structure-Based Drug Design:

    • Structural characterization of recombinant mt:ATPase6 can guide the design of specific inhibitors

    • Molecular docking studies can predict binding modes of potential inhibitors

    • Fragment-based approaches can develop high-affinity ligands targeting unique features of the mosquito protein

  • Epitope Identification for Immunological Control:

    • Recombinant protein can be used to identify immunogenic epitopes

    • Development of antibodies that specifically recognize mt:ATPase6

    • These antibodies could be incorporated into transmission-blocking strategies

  • Validation in Transgenic Systems:

    • Knowledge gained from recombinant protein studies can inform the development of transgenic approaches

    • Targeted disruption of mt:ATPase6 function through RNA interference or genome editing

    • Creation of modified mt:ATPase6 variants that confer susceptibility to specific compounds

Previous work with recombinant Aedes aegypti densovirus has demonstrated the feasibility of expressing foreign proteins in mosquito systems, providing a potential delivery mechanism for mt:ATPase6-targeting compounds or peptides .

What insights can be gained from studying ATP synthase evolution across different mosquito species?

Studying ATP synthase evolution across mosquito species provides valuable insights into both fundamental evolutionary processes and potential applications for vector control:

  • Molecular Clock Analysis:

    • The rate of sequence divergence in mt:ATPase6 can serve as a molecular clock for estimating divergence times between mosquito lineages

    • Comparison of substitution rates between mt:ATPase6 and other mitochondrial genes can reveal selective pressures specific to energy metabolism

  • Adaptation Signatures:

    • Identification of positively selected sites in mt:ATPase6 may reveal adaptations to different ecological niches

    • Correlation of sequence variations with habitat preferences, feeding behaviors, or geographic distribution

  • Co-evolution Patterns:

    • Analysis of evolutionary rates between interacting subunits of ATP synthase can reveal co-evolutionary constraints

    • These patterns help identify critical interaction interfaces that may serve as targets for species-specific inhibitors

  • Horizontal Gene Transfer Assessment:

    • Examination of unusual sequence similarities across distant lineages may reveal instances of horizontal gene transfer

    • Such events could influence vector competence or insecticide resistance

Evolutionary analysis of ATP synthase components has revealed major divergences within the alveolate clade, suggesting that significant functional innovations can occur in this ancient and essential enzyme complex . Similar evolutionary innovations may exist within mosquito lineages, potentially offering unique targets for vector-specific interventions.

How do post-translational modifications of mt:ATPase6 differ between mosquito species and how might this affect function?

Post-translational modifications (PTMs) of mt:ATPase6 represent an important but understudied aspect of ATP synthase regulation in mosquitoes. While specific comparative data on PTMs in Aedes albopictus mt:ATPase6 versus other mosquito species is limited, several key considerations for researchers include:

Common PTMs in ATP Synthase Components:

  • Phosphorylation: Likely the most prevalent PTM affecting ATP synthase function, with potential sites on serine, threonine, and tyrosine residues. Phosphorylation can modulate enzyme activity, complex assembly, and interactions with regulatory proteins.

  • Acetylation: Frequently observed in mitochondrial proteins, acetylation can influence protein stability, localization, and function.

  • Oxidative modifications: ROS-mediated modifications can affect enzyme activity, particularly in the context of aging or stress responses.

Species-Specific Considerations:

The pattern and functional consequences of these modifications may vary between mosquito species due to:

  • Differential expression of modifying enzymes: Species-specific kinases, phosphatases, acetyltransferases, and deacetylases may target mt:ATPase6 differently.

  • Variation in modification sites: Sequence divergence between species may create or eliminate potential modification sites.

  • Environmental adaptations: Species adapted to different ecological niches may utilize PTMs differently to regulate ATP synthase in response to environmental stressors.

Methodological Approaches:

To study species-specific PTMs, researchers can employ:

  • Mass spectrometry-based proteomics to identify and quantify modification sites

  • Phospho-specific or acetylation-specific antibodies for Western blotting

  • Site-directed mutagenesis of putative modification sites to assess functional impacts

  • Comparative analysis of kinase/phosphatase or acetyltransferase/deacetylase activity across species

What are the major technical challenges in expressing and purifying functional recombinant mt:ATPase6?

Researchers face several significant technical challenges when working with recombinant Aedes albopictus mt:ATPase6:

  • Membrane Protein Solubility:

    • As a hydrophobic membrane protein, mt:ATPase6 is inherently difficult to maintain in a soluble, properly folded state

    • Selection of appropriate detergents or amphipols is critical for extraction and purification

    • Finding conditions that balance protein solubility with native-like folding remains challenging

  • Expression Host Limitations:

    • E. coli expression systems may lack appropriate chaperones for correct folding

    • Codon usage differences between mosquito and bacterial systems can reduce expression efficiency

    • Toxicity of overexpressed membrane proteins can limit yields

  • Functional Assessment Complexities:

    • mt:ATPase6 functions as part of a multi-subunit complex, making isolated functional assessment difficult

    • Reconstitution into liposomes or nanodiscs requires optimization of lipid composition

    • Orientation in membranes must be controlled to accurately assess function

  • Stability Issues:

    • Purified recombinant protein tends to aggregate during concentration steps

    • Freeze-thaw cycles can significantly reduce activity, necessitating careful aliquoting and storage

    • Long-term storage requires optimization with stabilizing agents like trehalose (6%) and glycerol (5-50%)

To address these challenges, alternative approaches such as co-expression with other ATP synthase subunits or expression of modified constructs with solubility-enhancing tags may prove beneficial.

How might structural biology techniques be applied to better understand mt:ATPase6 function in mosquitoes?

Advanced structural biology techniques offer promising approaches to better understand mt:ATPase6 function in mosquitoes:

Recent advances in structural studies of apicomplexan F-type ATP synthases demonstrate the feasibility of these approaches for divergent ATP synthase complexes . Application of similar techniques to mosquito ATP synthase could reveal unique structural features with implications for vector control.

What emerging technologies might advance our understanding of mt:ATPase6 in vector biology and mosquito control?

Several emerging technologies hold promise for advancing our understanding of mt:ATPase6 in vector biology and developing novel control strategies:

  • CRISPR/Cas9 Genome Editing:

    • Precise genetic modification of mt:ATPase6 in mosquitoes

    • Creation of mosquito lines with tagged versions for in vivo localization and interaction studies

    • Generation of conditional knockdowns to assess tissue-specific functions

    • Introduction of mutations to assess resistance mechanisms to ATP synthase inhibitors

  • Single-Cell Transcriptomics and Proteomics:

    • Analysis of mt:ATPase6 expression patterns at unprecedented resolution

    • Identification of cell types with particularly high ATP synthase activity

    • Characterization of expression changes during development and after blood feeding

    • Discovery of correlation patterns with other genes suggesting regulatory networks

  • In Silico Drug Discovery:

    • AI-powered screening of virtual compound libraries against modeled mt:ATPase6 structures

    • Molecular dynamics simulations to identify transient binding pockets

    • Design of allosteric modulators targeting mosquito-specific regulatory mechanisms

    • Quantum mechanical calculations to optimize inhibitor binding energetics

  • Synthetic Biology Approaches:

    • Engineering of modified ATP synthase complexes with altered properties

    • Development of genetic circuits responsive to ATP synthase inhibition

    • Creation of transgenic mosquitoes with susceptible ATP synthase variants for population replacement strategies

    • Directed evolution of mt:ATPase6 to understand adaptation mechanisms

  • Advanced Imaging Technologies:

    • Super-resolution microscopy to visualize ATP synthase distribution in mosquito tissues

    • Live-cell imaging of ATP synthase dynamics during different physiological states

    • Correlative light and electron microscopy to connect functional data with ultrastructural context

These technologies could be particularly valuable when applied to understanding the role of mt:ATPase6 in the context of changing energy demands associated with blood feeding, which represents a critical physiological transition in female mosquitoes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.