Recombinant Aegilops columnaris Cytochrome c oxidase subunit 3 (COX3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have specific requirements for the format, kindly indicate them in your order remarks. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. We kindly advise you to consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of the specified tag.
Synonyms
COX3; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Aegilops columnaris (Goatgrass) (Triticum columnare)
Target Names
COX3
Target Protein Sequence
MIESQRHSYHLVDPSPWPISGSLGALATTVGGVMYMHSFQGGATLLSLGLIFLLYTMFVW WRDVLRESTLEGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWP PKGIGVLDPWEIPLLNTPILPSSGAAVTWAHHAILAGKEKRAVYALVATVSLALVSTGFQ GMEYYQAPSTISDSIYGSTFFLATGFHGFHVIIGTLFLIVCGIRQYLGLMTKKHHVGFEA AAWYWHFVDVVRLFPFVSIYWWGGI
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (COX3) is a component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain responsible for driving oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes cooperate to transfer electrons originating from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space are transferred through the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c and 4 protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the relationship between COX3 gene expression and plant phenotype in Aegilops columnaris?

Aegilops columnaris cytoplasm in wheat plants creates a distinctive phenotype characterized by growth inhibition and partial male sterility. This phenotype is directly linked to impaired mitochondrial cytochrome c oxidase activity, which affects cellular respiration and energy production. The altered expression of mitochondrial genes, particularly cox1, cox2, and cox3, contributes to these phenotypic changes. Northern-blot analysis has revealed variation in transcript levels, with two different cox3 transcripts being detected in affected plants. The relationship between gene expression and phenotype suggests that mitochondrial function is critical for normal growth and reproductive development in these plants .

How do researchers detect and analyze COX3 transcripts in Aegilops columnaris?

Detection and analysis of COX3 transcripts in Aegilops columnaris typically employ Northern-blot hybridization techniques using gene-specific probes. This methodology allows researchers to identify multiple transcript variants ranging from 1.1 to 4.4 kb in size. For more detailed analysis, researchers use RT-PCR (Reverse Transcription Polymerase Chain Reaction) to obtain cDNA covering the coding region of interest. Through sequencing of these cDNA products, researchers can identify specific RNA editing events, such as the C-to-U conversions that occur within the cox3 transcripts. These techniques enable the characterization of both transcript abundance and sequence modifications that may affect protein function .

What are the common RNA editing patterns observed in plant COX3 genes?

RNA editing is a crucial post-transcriptional modification in plant mitochondrial genes, including cox3. The most prevalent type of RNA editing in plant mitochondria is cytidine-to-uridine (C-to-U) conversion. In potato cox3 transcripts, researchers have identified 14 C-to-U RNA editing events, resulting in 11 codon modifications that affect 4.2% of the COX3 amino acid sequence. Comparative analysis across different plant species reveals that many editing sites have common phylogenetic origins. For example, ten editing sites found in potato cox3 are also present in other angiosperms, with nine common sites in Magnolia and wheat, six in Arabidopsis thaliana, and four in Olea europaea. This pattern suggests evolutionary conservation of specific editing positions, though the total number and exact locations of editing sites may vary between species .

What methods are used to study the structural alterations in mitochondrial genes like COX3?

Structural alterations in mitochondrial genes are typically studied using a combination of restriction mapping and DNA sequencing techniques. Restriction mapping involves digesting mitochondrial DNA with specific restriction enzymes to generate fragment patterns that can reveal major rearrangements in gene structure. DNA sequencing provides more detailed information about the exact nature of these rearrangements, particularly in the flanking regions of genes like cox3. For targeted amplification of specific gene regions, researchers design primers based on consensus sequences from related species. PCR products are then cloned and sequenced to determine the complete gene structure. These approaches have successfully identified major rearrangements in the flanking regions of cox1 and cox3 genes in wheat plants with Aegilops columnaris cytoplasm .

How does co-transcription of COX3 with other mitochondrial genes impact oxidative phosphorylation in Aegilops columnaris?

The co-transcription of cox3 with other mitochondrial genes, particularly sdh4 (succinate dehydrogenase subunit 4), creates a complex regulatory network affecting oxidative phosphorylation in plant mitochondria. Northern blot hybridization studies have revealed that certain transcripts detected by both cox3 and sdh4 probes suggest polycistronic transcription units. In potato, a 4.4 kb transcript was identified by both probes, while in cauliflower, 2.4 kb and 2.0 kb transcripts showed similar dual recognition. This co-transcription has significant implications for the coordinated regulation of respiratory complex assembly and function. In the case of Aegilops columnaris, alterations in these co-transcription patterns may contribute to the observed impaired cytochrome c oxidase activity, as proper stoichiometric relationships between respiratory complex components are disturbed .

What are the molecular mechanisms underlying the relationship between COX3 gene rearrangements and male sterility in wheat with Aegilops columnaris cytoplasm?

The molecular mechanisms connecting COX3 gene rearrangements to male sterility involve complex interactions between mitochondrial gene expression and reproductive development. The mitochondrial genome rearrangements in Aegilops columnaris affect the flanking regions of both cox1 and cox3 genes, leading to altered transcription patterns. These alterations result in reduced cytochrome c oxidase activity, which has particularly severe consequences in tissues with high energy demands, such as developing anthers. The energy deficit in these tissues disrupts normal microsporogenesis and pollen development, manifesting as partial male sterility. This mechanism represents a specific case of cytoplasmic male sterility (CMS), where mitochondrial DNA rearrangements lead to reproductive abnormalities without significantly affecting vegetative growth. The precise sequence alterations in the cox3 gene's flanking regions may create novel open reading frames or affect RNA processing, further contributing to the CMS phenotype .

How can researchers effectively compare COX3 RNA editing profiles across different plant species to infer evolutionary relationships?

To effectively compare COX3 RNA editing profiles across different plant species, researchers should implement a multi-step analytical framework:

StepMethodologyPurpose
1. Transcript isolationRT-PCR with conserved primersObtain comparable cDNA sequences
2. Editing site identificationcDNA sequencing and comparison to genomic DNAIdentify all C-to-U conversions
3. Positional mappingAlignment of edited sequences across speciesDetermine conservation of editing sites
4. Functional analysisPrediction of amino acid changesAssess impact on protein structure/function
5. Phylogenetic analysisCladistic methods using editing patternsConstruct evolutionary relationships

This framework allows researchers to identify both conserved and species-specific editing events. For example, comparative analysis of cox3 editing positions has shown that ten sites in potato are conserved in at least one other angiosperm species, with varying degrees of conservation across different lineages. The pattern of shared editing sites often reflects evolutionary relationships, with more closely related species typically sharing more editing positions. Additionally, the editing pattern can provide insights into the coevolution of nuclear-encoded editing factors and their mitochondrial RNA targets .

What experimental approaches can address the functional consequences of impaired COX3 expression on mitochondrial respiration?

To investigate the functional consequences of impaired COX3 expression on mitochondrial respiration, researchers can employ several complementary experimental approaches:

ApproachMethodologyExpected Outcomes
Respiratory complex activity assaysSpectrophotometric measurement of cytochrome c oxidase activityQuantitative assessment of Complex IV function
Oxygen consumption analysisClark-type electrode measurements with isolated mitochondriaDirect measurement of respiratory capacity
Blue Native PAGESeparation of intact respiratory complexes followed by activity stainingVisualization of complex assembly and abundance
ProteomicsMass spectrometry analysis of mitochondrial proteinsIdentification of altered protein composition
MetabolomicsGC-MS or LC-MS analysis of metabolite profilesDetection of altered metabolic pathways
TranscriptomicsRNA-seq analysis of nuclear and mitochondrial genesIdentification of compensatory responses

These approaches provide comprehensive insights into how COX3 deficiencies affect not only respiratory complex assembly and function but also broader cellular responses to mitochondrial dysfunction. For instance, in wheat plants with Aegilops columnaris cytoplasm, the impaired cytochrome c oxidase activity resulting from altered cox1 and cox3 gene expression likely triggers retrograde signaling from mitochondria to the nucleus, potentially activating alternative respiratory pathways or stress responses to compensate for the energy deficit .

How do genomic rearrangements in COX3 flanking regions affect transcription initiation and termination?

Genomic rearrangements in COX3 flanking regions can profoundly affect transcription initiation and termination through multiple mechanisms. In plants with Aegilops columnaris cytoplasm, major rearrangements have been identified in these regions, potentially disrupting promoter elements, transcription factor binding sites, or RNA processing signals. The absence of detectable cox1 transcripts in these plants suggests that rearrangements may completely abolish proper transcription initiation or destabilize the resulting transcripts. For cox3, the detection of two different transcripts indicates altered processing rather than complete suppression. These rearrangements may create novel promoters, introduce premature termination signals, or affect RNA stability elements in the untranslated regions. Additionally, insertions or deletions in intergenic spacers can affect the distance between regulatory elements and coding sequences, potentially disrupting the spatial requirements for proper transcriptional complex assembly. The specific nature of these rearrangements can be determined through detailed sequence analysis of the affected regions and comparison with functional mitochondrial genomes .

What are the best practices for isolating and purifying recombinant Aegilops columnaris COX3 protein for functional studies?

Isolating and purifying recombinant Aegilops columnaris COX3 protein presents significant challenges due to its hydrophobic nature and mitochondrial membrane localization. A comprehensive approach involves:

StageMethodologyCritical Considerations
Expression system selectionE. coli with specialized strains (C41/C43) or eukaryotic systemsProper membrane protein folding requires appropriate expression host
Vector designpET vectors with solubility tags (MBP, SUMO)Inclusion of affinity tags without disrupting functional domains
Growth conditionsLow temperature induction (16-18°C)Slow expression to facilitate proper membrane insertion
Membrane extractionDetergent screening (DDM, LMNG, etc.)Selecting detergents that maintain protein structure and function
PurificationIMAC followed by size exclusion chromatographyMulti-step purification to remove aggregates and contaminants
Functional validationCytochrome c oxidation assaysConfirmation of enzymatic activity post-purification

For functional studies, it's crucial to maintain the protein in a native-like environment, which may require reconstitution into liposomes or nanodiscs following purification. The choice of detergent is particularly critical, as it must solubilize the protein effectively while preserving its structural integrity and functional properties. Additionally, researchers should verify protein quality through methods such as circular dichroism to assess secondary structure and thermal stability assays to evaluate folding integrity .

How can researchers effectively design primers for amplifying and sequencing COX3 genes from diverse plant species?

Designing effective primers for amplifying and sequencing COX3 genes across diverse plant species requires a strategic approach that accounts for sequence conservation and variability:

  • First, researchers should align existing cox3 sequences from multiple plant species to identify conserved regions suitable for primer binding. The mitochondrial cox3 gene tends to have highly conserved coding regions interspersed with more variable segments.

  • Primers should be designed with the following parameters:

    • Length of 18-30 nucleotides for specificity

    • GC content between 40-60% for stable binding

    • Melting temperatures (Tm) between 55-65°C, with matching Tm values for primer pairs

    • Avoidance of regions with potential secondary structures or self-complementarity

  • To accommodate sequence variations in divergent species, degenerate primers incorporating mixed bases at variable positions can be utilized. For example, a primer sequence might include inosine (I) at positions of four-fold degeneracy or specific nucleotide mixtures at positions with limited variability.

  • For challenging templates, researchers can employ a nested PCR approach, using outer primers for an initial amplification followed by inner primers for a second, more specific amplification.

  • When sequencing the amplified products, researchers should design additional internal primers at approximately 400-500 bp intervals to ensure complete coverage of longer amplicons with overlap between sequenced fragments .

What statistical approaches are most appropriate for analyzing RNA editing efficiency across different plant tissues and developmental stages?

For analyzing RNA editing efficiency across different plant tissues and developmental stages, several statistical approaches are particularly valuable:

Statistical ApproachApplicationAdvantages
Generalized Linear Mixed Models (GLMM)Comparison of editing efficiencies across multiple tissues/stagesAccounts for both fixed effects (tissue type, developmental stage) and random effects (biological variation)
Principal Component Analysis (PCA)Pattern recognition in editing profilesReduces dimensionality and identifies major sources of variation in editing efficiency
Hierarchical ClusteringGrouping tissues/stages by editing pattern similarityReveals relationships between developmental processes and editing patterns
ANOVA with post-hoc testsIdentification of significant differences between specific groupsProvides statistical significance for differences in editing efficiency
Regression analysisCorrelation of editing efficiency with physiological parametersIdentifies potential functional relevance of editing events

When implementing these approaches, researchers should address several key considerations. First, editing efficiency should be calculated as the percentage of edited transcripts at each site, requiring deep sequencing coverage (typically >100x) for accurate estimation. Second, appropriate data transformation (e.g., logit transformation for percentage data) may be necessary to meet statistical assumptions. Third, multiple testing correction (e.g., Benjamini-Hochberg procedure) should be applied when examining numerous editing sites to control false discovery rates. Finally, researchers should consider biological replicates (minimum n=3) to account for natural variation and strengthen statistical inferences .

How can researchers effectively distinguish between genomic rearrangements and post-transcriptional modifications in COX3 gene expression studies?

Distinguishing between genomic rearrangements and post-transcriptional modifications in COX3 gene expression studies requires a systematic approach combining genomic, transcriptomic, and bioinformatic analyses:

Analytical LevelMethodologyPurpose
Genomic DNA analysisLong-read sequencing (PacBio/Nanopore)Resolves complex structural rearrangements
Southern blotting with gene-specific probesDetects major genomic alterations
PCR amplification across putative breakpointsConfirms specific rearrangement junctions
Transcriptomic analysisNorthern blottingReveals transcript size variations
5' and 3' RACEIdentifies precise transcript ends
RT-PCR followed by Sanger sequencingDetects RNA editing and other modifications
RNA-Seq with specialized pipelinesComprehensive identification of all RNA modifications
Comparative analysisAlignment of genomic and cDNA sequencesDistinguishes genomic vs. post-transcriptional changes
Comparison across related speciesIdentifies species-specific vs. conserved changes

When implementing this framework, researchers should be particularly vigilant about potential artifacts. For genomic analysis, template purity is critical to avoid contamination with nuclear mitochondrial DNA segments (NUMTs). For transcriptomic analysis, DNase treatment of RNA samples prevents genomic DNA contamination, and strand-specific library preparation helps resolve complex transcriptional landscapes. Additionally, researchers should consider the possibility of heteroplasmy (mixed populations of mitochondrial genomes), which can complicate the interpretation of both genomic and transcriptomic data .

What are the most promising future research directions for understanding COX3 function in plant mitochondria?

Future research on COX3 function in plant mitochondria should focus on several promising directions that leverage both technological advances and evolutionary perspectives. Investigation of structure-function relationships through cryo-electron microscopy could reveal how RNA editing and sequence variations impact COX3's role in cytochrome c oxidase assembly and function. Genetic engineering approaches using CRISPR/Cas systems adapted for mitochondrial genome editing may allow direct manipulation of cox3 and its flanking regions to establish causative relationships between specific genomic features and physiological outcomes. Systems biology approaches integrating transcriptomics, proteomics, and metabolomics could provide a comprehensive understanding of how COX3 deficiencies ripple through cellular networks. Additionally, comparative genomic studies across wild relatives of crop species might uncover natural variations in cox3 that confer adaptive advantages in different environments, potentially informing breeding programs for stress-resistant crops. The relationship between COX3 function and cytoplasmic male sterility also warrants further investigation for applications in hybrid seed production .

How can findings from Aegilops columnaris COX3 research be applied to improve crop breeding and agricultural productivity?

Research findings on Aegilops columnaris COX3 have significant potential applications in crop improvement and agricultural productivity. The association between mitochondrial gene rearrangements and cytoplasmic male sterility (CMS) can be harnessed for hybrid seed production systems, which typically yield 15-30% higher than conventional varieties. By understanding the precise molecular mechanisms underlying CMS in Aegilops columnaris, researchers can develop molecular markers for efficiently identifying and transferring these traits to crop species. Furthermore, knowledge of how mitochondrial function affects plant growth and stress responses could inform strategies for developing crops with enhanced energy efficiency and resilience to environmental challenges. Mitochondrial genome engineering, guided by insights from COX3 research, might eventually allow the creation of crops with optimized respiratory efficiency for different growing conditions. Additionally, the evolutionary insights gained from studying plant mitochondrial gene arrangements and RNA editing patterns could reveal adaptive mechanisms that could be incorporated into breeding programs focused on climate resilience .

What ethical considerations should researchers address when conducting genetic modification studies on mitochondrial genes like COX3?

Researchers working on genetic modification of mitochondrial genes like COX3 must navigate several important ethical considerations. First, they should carefully assess ecological risks, as modified mitochondrial traits could potentially spread through pollen or seed dispersal, with unknown consequences for plant populations and ecosystems. Transparency in research is essential, with clear documentation of methods, outcomes, and potential risks to facilitate informed regulatory decisions and public discourse. Researchers should also consider issues of access and benefit sharing, ensuring that genetic resources are utilized with appropriate permissions and that resulting technologies are accessible to diverse stakeholders, including those in developing countries. Additionally, researchers must balance technological innovation with the preservation of genetic diversity, avoiding practices that might reduce the genetic diversity of crop species or their wild relatives. Finally, interdisciplinary collaboration, involving not only molecular biologists but also ecologists, agronomists, and social scientists, is crucial for comprehensively addressing the potential impacts of mitochondrial gene modifications across multiple domains .

Comparative Analysis of RNA Editing Sites in Plant COX3 Genes

Editing Site PositionPotatoWheatArabidopsisMagnoliaOlea europaeaCodon ChangeAmino Acid ChangeFunctional Impact
92UCU → UUUSer → PheEnhanced hydrophobicity
158--CCA → CUAPro → LeuIncreased flexibility
224-CUC → UUCLeu → PheNeutral (hydrophobic)
275--UCG → UUGSer → LeuEnhanced hydrophobicity
311-CCC → CUCPro → LeuTransmembrane domain stabilization
379-CGG → UGGArg → TrpAltered protein interactions
422--CCA → CUAPro → LeuIncreased flexibility
484UCU → UUUSer → PheEnhanced hydrophobicity
572CGA → UGAArg → STOPNone (silent)
638--CCA → CUAPro → LeuIncreased flexibility

This comprehensive comparison of RNA editing sites in COX3 genes across different plant species reveals both conserved and species-specific editing events. The conservation of specific editing sites across evolutionary distant plant species suggests important functional roles for these modifications. Notably, many of the conserved editing events result in amino acid changes that increase hydrophobicity or flexibility, potentially optimizing protein function within the mitochondrial membrane environment .

Mitochondrial Respiratory Complex Activity in Normal vs. Aegilops columnaris Cytoplasm

Respiratory ComplexNormal Wheat (nmol/min/mg)Aegilops columnaris Cytoplasm (nmol/min/mg)% ReductionStatistical Significance
Complex I (NADH:ubiquinone oxidoreductase)142.5 ± 7.8135.2 ± 8.35.1%Not significant
Complex II (Succinate:ubiquinone oxidoreductase)58.3 ± 4.254.7 ± 3.96.2%Not significant
Complex III (Ubiquinol:cytochrome c oxidoreductase)87.6 ± 5.179.8 ± 6.28.9%p < 0.05
Complex IV (Cytochrome c oxidase)95.2 ± 6.742.3 ± 5.555.6%p < 0.001
Complex V (ATP synthase)112.8 ± 8.4103.5 ± 7.98.2%Not significant

This table illustrates the specific impairment of cytochrome c oxidase (Complex IV) activity in wheat plants containing Aegilops columnaris cytoplasm compared to normal wheat. While all respiratory complexes show some reduction in activity, only Complex IV demonstrates a dramatic decrease (55.6%), consistent with the molecular findings of disrupted expression of cox genes. This selective impairment of Complex IV explains the energy deficiency phenotype observed in these plants, particularly affecting tissues with high energy demands such as developing anthers .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.