Recombinant Aegilops crassa Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Aegilops crassa Photosystem I Assembly Protein Ycf4 (ycf4)

Recombinant Aegilops crassa Photosystem I assembly protein Ycf4 (ycf4) is a protein crucial for the accumulation of Photosystem I (PSI) in photosynthetic organisms . Ycf4 is a thylakoid protein, meaning it is located within the thylakoid membranes of chloroplasts, where photosynthesis takes place . It is essential for the stable accumulation of the PSI complex, a large protein complex involved in light-dependent reactions of photosynthesis .

Functional Role in Photosystem I Assembly

  • Essential for PSI Accumulation Ycf4 is vital for the stable accumulation of the PSI complex in thylakoid membranes . Mutants lacking Ycf4 are unable to grow photoautotrophically and are deficient in PSI activity .

  • Scaffolding Role Biochemical and structural studies suggest that the Ycf4 complex acts as a scaffold for PSI assembly . It interacts with newly synthesized PSI polypeptides, facilitating their assembly into a pigment-containing subcomplex .

  • Interaction with PSI Subunits Ycf4 interacts directly with PSI subunits PsaA and PsaD, but not with other photosynthetic complexes, indicating its specific role in PSI assembly .

Experimental Evidence and Research Findings

ExperimentFindings
Tandem Affinity PurificationA stable Ycf4-containing complex of >1500 kD was purified, which included COP2 and PSI subunits PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF .
Sucrose Gradient Ultracentrifugation and Ion Exchange ChromatographyAlmost all Ycf4 and COP2 in wild-type cells copurified, indicating a close association between these proteins .
Electron MicroscopyThe purified Ycf4 preparation revealed large structures measuring 285 x 185 Å, suggesting oligomeric states .
Pulse-Chase Protein LabelingPSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as a pigment-containing subcomplex .
Mutational AnalysisDisruption of ycf4 in Chlamydomonas reinhardtii resulted in an inability to grow photoautotrophically and a deficiency in PSI activity .
Immunoblot AnalysisYcf4 interacts directly with the PSI subunits PsaA and PsaD, but not with subunits from other photosynthetic complexes .

Role of COP2 in Ycf4 Complex Stability

COP2, an opsin-related protein, is intimately and exclusively associated with Ycf4 . While COP2 is part of the Ycf4 complex, it is not essential for PSI assembly . A decrease in COP2 levels increases the salt sensitivity of the Ycf4 complex, suggesting that COP2 contributes to the stability of the complex but is not crucial for PSI accumulation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your preparations.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Aegilops crassa (Persian goatgrass) (Triticum crassum)
Target Names
ycf4
Target Protein Sequence
MNWRSEHIWVELLKGSRKRGNFFWACILFLGSLGFLSVGISSYLGKNIISILPSQEILFF PQGVVMSFYGIAGLFISSYLWCTILWNVGSGYDRFDRKEGIVCIFRWGFPGIKRRVFLRF LMRDIQSIRIQVKEGLYPRRILYMEIRGQGIIPLTRTDDKFFTPREIEQKAAELAYFLRV PIEVF
Uniprot No.

Target Background

Function
Appears essential for the assembly of the photosystem I complex.
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Ycf4 and what is its primary function?

Ycf4 is a thylakoid membrane protein encoded by the chloroplast genome (ycf4 gene) that plays an essential role in the assembly of Photosystem I (PSI) complexes in photosynthetic organisms. Research in Chlamydomonas reinhardtii has demonstrated that Ycf4 functions as a scaffold for PSI assembly, participating specifically in early processes of PSI complex assembly . It stabilizes an intermediate subcomplex consisting of the PsaA-PsaB heterodimer and facilitates the addition of other PSI subunits . Without functional Ycf4, organisms like Chlamydomonas cannot assemble mature PSI complexes, resulting in impaired photosynthetic capacity .

How conserved is Ycf4 across photosynthetic organisms?

Ycf4 is highly conserved among oxygenic photosynthetic organisms, including cyanobacteria, green algae, and land plants. Certain amino acid residues, particularly R120, E179, and E181, are conserved across these diverse organisms, indicating their functional importance . Despite this conservation, the evolution of ycf4 shows unusual patterns in certain plant lineages. In legumes, for example, ycf4 is subject to localized hypermutation, with mutation rates at least 20 times higher than elsewhere in the chloroplast genome . This has led to dramatic sequence divergence, with the Ycf4 protein showing more variation within the single genus Lathyrus than between cyanobacteria and other angiosperms .

Why would researchers work with recombinant Ycf4 instead of native protein?

Researchers opt for recombinant Ycf4 protein for several methodological advantages. First, recombinant expression systems allow for controlled production of sufficient protein quantities for biochemical and structural studies. Second, recombinant approaches enable site-directed mutagenesis to investigate the functional significance of specific amino acid residues, as demonstrated in studies where conserved residues R120, E179, and E181 were altered to assess their contribution to Ycf4 function . Third, recombinant proteins can be engineered with affinity tags to facilitate purification and protein interaction studies, such as the tandem affinity purification tagged Ycf4 used to isolate and characterize the large Ycf4-containing complex .

What is the relationship between Ycf4 and Photosystem I assembly?

Ycf4 functions as a critical assembly factor for Photosystem I. Research has identified that Ycf4 acts as the second of three scaffold proteins that function sequentially during PSI assembly . Its specific roles include:

  • Stabilizing an intermediate PSI subcomplex consisting of the PsaA-PsaB heterodimer and the stromal subunits PsaCDE

  • Facilitating the addition of the PsaF subunit to this intermediate complex

  • Serving as a physical scaffold for the assembly process

Pulse-chase protein labeling experiments have confirmed that the PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as a pigment-containing subcomplex, further supporting Ycf4's role in early assembly processes .

What molecular mechanisms underlie Ycf4's function in PSI assembly?

The molecular mechanisms of Ycf4 function involve specific amino acid residues that are critical for its activity. Site-directed mutagenesis studies have identified that the conserved glutamic acid residues E179 and E181 play crucial roles in Ycf4 functionality . When both residues were replaced with glutamine (E179/181Q double mutant), Ycf4 accumulated at normal levels but completely failed to assemble mature PSI complexes . This double mutant accumulated a small PSI subcomplex (150-170 kDa) consisting of a PsaA-PsaB heterodimer, which represents an assembly intermediate that couldn't progress further due to the blocked Ycf4 function .

Biochemical studies have shown that Ycf4 exists in a large complex (>1500 kD) containing multiple proteins including PSI subunits (PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF) and the opsin-related protein COP2 . Electron microscopy has revealed that this complex forms large oligomeric structures measuring approximately 285 × 185 Å, suggesting that Ycf4 may function within a macromolecular assembly that facilitates the organized construction of PSI complexes .

How does the absence of Ycf4 affect chloroplast ultrastructure?

Transmission electron microscopy (TEM) of ycf4 knockout plants has revealed significant ultrastructural changes in chloroplasts compared to wild-type plants. These changes include:

  • Altered chloroplast morphology - knockout plants have smaller, rounded chloroplasts compared to the larger, oblong chloroplasts in wild-type plants

  • Reduced thylakoid membrane organization - thylakoid membranes are less densely packed in knockout plants

  • Disrupted grana structure - grana thylakoids are less discrete with compromised orderly structure

  • Formation of vesicular structures in chloroplasts where thylakoid membranes become disorganized

What explains the unusual evolutionary patterns of ycf4 in certain plant lineages?

The ycf4 gene exhibits remarkable evolutionary patterns, particularly in legumes where it shows localized hypermutation and has been lost independently in multiple lineages. This evolutionary pattern is highly unusual, as the local point mutation rate in the ycf4 region is at least 20 times higher than elsewhere in the chloroplast genome . Several hypotheses might explain this phenomenon:

  • The hypermutable region may be subject to an unusual process such as repeated DNA breakage and repair

  • The accelerated evolution might reflect relaxed selective constraints on ycf4 function in certain lineages

  • The gene may have relocated to the nuclear genome in some species, allowing the chloroplast copy to accumulate mutations before eventually being lost

How might Ycf4 structure-function relationships differ in Aegilops crassa compared to model organisms?

While specific data on Aegilops crassa Ycf4 is not presented in the search results, comparative analysis suggests several potential differences in structure-function relationships:

  • As a wheat relative, Aegilops crassa likely maintains a functional ycf4 gene unlike some legumes that have lost it

  • The protein may have evolved unique structural features adapted to Aegilops' photosynthetic requirements under its native environmental conditions

  • The interaction partners of Ycf4 might differ in Aegilops compared to Chlamydomonas or other model organisms

To investigate these potential differences, researchers could conduct comparative sequence analysis of ycf4 across Aegilops species and related Triticeae, examine conservation of the functionally important residues identified in Chlamydomonas (R120, E179, E181), and analyze the composition of PSI assembly complexes in Aegilops chloroplasts through proteomic approaches.

What are the best strategies for expressing recombinant Ycf4 protein?

Based on successful approaches in the literature, optimal strategies for expressing recombinant Ycf4 include:

  • Expression system selection: For functional studies, using either a prokaryotic (E. coli) system for basic biochemical characterization or a eukaryotic system (yeast or insect cells) for studies requiring post-translational modifications is recommended.

  • Construct design: Including affinity tags (such as the tandem affinity purification tag used in previous studies) facilitates purification and interaction studies . Considering Ycf4's membrane association, designing constructs with appropriate solubilization domains may improve expression and purification yields.

  • Codon optimization: Adapting the coding sequence to the codon usage of the expression host can significantly improve protein yield, particularly important for chloroplast-encoded genes which may have different codon preferences.

  • Solubilization and purification: Employing appropriate detergents or amphipols for membrane protein solubilization is crucial. Previous studies have successfully used sucrose gradient ultracentrifugation followed by ion exchange chromatography to purify Ycf4-containing complexes .

What mutagenesis approaches are most informative for Ycf4 functional studies?

Based on previous research, the following mutagenesis approaches have proven informative for Ycf4 functional studies:

  • Site-directed mutagenesis of conserved residues: Targeting highly conserved amino acids, particularly R120, E179, and E181, has revealed their differential contributions to Ycf4 function . This approach can be expanded to other conserved residues identified through sequence alignment across diverse species including Aegilops.

  • Domain swapping: Exchanging domains between Ycf4 proteins from different species (e.g., cyanobacteria, algae, and higher plants) can help identify regions responsible for species-specific functions or interactions.

  • Deletion analysis: Creating systematic truncations can help map functional domains and minimal regions required for PSI assembly function.

  • Chimeric protein construction: Fusing domains of Ycf4 with reporter proteins or interaction domains can help track localization, assembly kinetics, and protein-protein interactions in vivo.

The table below summarizes the effects of key mutations on Ycf4 function based on previous studies:

MutationYcf4 AccumulationPSI AssemblyPhotosynthetic GrowthReference
R120A80% reductionFunctionalNormal
R120Q80% reductionFunctionalNormal
E179ANormalFunctionalNormal
E179QNormalFunctionalNormal
E181QNormalFunctionalNormal
E181ANormalReducedReduced
E179/181ANormalReducedReduced
E179/181QNormalNoneImpaired
Complete lossNoneNoneRequires sucrose

How can researchers effectively analyze Ycf4-containing complexes?

Effective analysis of Ycf4-containing complexes requires a multi-faceted approach:

  • Protein complex isolation: Tandem affinity purification (TAP) tagging of Ycf4 has been successfully used to purify intact Ycf4-containing complexes . This approach can be combined with gentle solubilization using appropriate detergents to maintain complex integrity.

  • Sucrose gradient ultracentrifugation: This technique effectively separates protein complexes based on size and has been used to identify the large (>1500 kD) Ycf4-containing complex .

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE): This technique preserves native protein-protein interactions and can separate intact complexes for subsequent analysis.

  • Mass spectrometry: Liquid chromatography-tandem mass spectrometry (LC-MS/MS) has been used to identify complex components, revealing that Ycf4 complexes contain PSI subunits PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF, as well as the opsin-related protein COP2 .

  • Electron microscopy: This technique has revealed the size and structure of Ycf4-containing particles (285 × 185 Å), providing insights into their oligomeric organization .

  • Pulse-chase protein labeling: This approach has demonstrated that PSI polypeptides associated with Ycf4 complexes are newly synthesized, confirming Ycf4's role in early assembly .

How can researchers address the challenges of working with recombinant membrane proteins like Ycf4?

Working with membrane proteins like Ycf4 presents several challenges that can be addressed through specialized approaches:

  • Expression challenges: Membrane proteins often express poorly in heterologous systems. Using specialized expression strains designed for membrane proteins or cell-free expression systems can improve yields. Additionally, fusion partners like maltose-binding protein (MBP) or thioredoxin can enhance solubility.

  • Protein solubilization: Identifying appropriate detergents is crucial. A detergent screening approach using a panel of different detergents (mild non-ionic detergents like DDM, LMNG, or digitonin) can identify conditions that maintain Ycf4 in a functional state while extracting it from membranes.

  • Maintaining native conformation: Amphipathic polymers (amphipols) or nanodiscs can stabilize membrane proteins in solution while maintaining their native structure better than conventional detergents. These approaches may be particularly valuable for functional and structural studies of Ycf4.

  • Reconstitution systems: For functional studies, reconstituting Ycf4 into proteoliposomes or nanodiscs with its interaction partners can provide a more native-like environment for assessing its activity in PSI assembly.

What are the best approaches for studying Ycf4 function in planta?

For investigating Ycf4 function within plant systems, several complementary approaches have proven valuable:

  • Chloroplast transformation: The development of chloroplast transformation vectors for targeted inactivation of ycf4, as demonstrated in tobacco studies, allows for direct manipulation of the native gene . This approach uses antibiotic resistance markers (such as aadA) and reporter genes (such as gfp) to select and verify transformants.

  • Complementation studies: Reintroducing wild-type or mutated versions of ycf4 into knockout plants can assess the functional significance of specific protein regions or residues. This approach can be used to test Aegilops crassa Ycf4 variants in model plant systems.

  • Phenotypic characterization: Comprehensive analysis of ycf4 mutants should include:

    • Growth measurements under different light conditions and carbon sources

    • Chlorophyll fluorescence to assess photosystem function

    • Thylakoid protein analysis by immunoblotting

    • Transmission electron microscopy to examine chloroplast ultrastructure

  • Protein-protein interaction studies: Techniques such as co-immunoprecipitation, bimolecular fluorescence complementation (BiFC), or proximity-based labeling approaches can identify Ycf4 interaction partners in planta and map the interaction network involved in PSI assembly.

How can evolutionary analysis inform functional studies of Ycf4?

Evolutionary analysis provides valuable insights for Ycf4 functional studies through several approaches:

  • Comparative sequence analysis: Analyzing ycf4 sequences across diverse photosynthetic organisms can identify conserved residues likely critical for function. This approach has already identified the functionally important R120, E179, and E181 residues .

  • dN/dS ratio analysis: Examining the ratio of nonsynonymous to synonymous substitution rates (dN/dS) can identify regions under positive or purifying selection. Studies have shown that ycf4 has accelerated evolution in legumes compared to other angiosperms, with no similar acceleration seen in other chloroplast genes like rbcL or matK .

  • Correlation with ecological adaptation: Investigating whether ycf4 sequence variation correlates with ecological factors (light environment, temperature extremes) could reveal adaptive modifications in the PSI assembly process.

  • Analysis of gene loss events: Understanding how organisms that have lost chloroplast-encoded ycf4 compensate for this loss can provide insights into alternative PSI assembly mechanisms or nuclear-encoded functional replacements. This is particularly relevant given the repeated independent losses of ycf4 in legumes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.