Recombinant Aegilops speltoides Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your own preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Aegilops speltoides (Goatgrass) (Triticum speltoides)
Target Names
ycf4
Target Protein Sequence
MNWRSEHIWVELLKGSRKRGNFFWACILFLGSLGFLSVGISSYLGKNIISILPSQEILFF PQGVVMSFYGIAGLFISSYLWCTILWNVGSGYDRFDRKEGIVCIFRWGFPGIKRRVFLRF LMRDIQSIRIQVKEGLYPRRILYMEIRGQGIIPLTRTDDKFFTPREIEQKAAELAYFLRV PIEVF
Uniprot No.

Target Background

Function
Essential for the assembly of the photosystem I complex.
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Ycf4 and what is its role in photosynthetic organisms?

Ycf4 is a 22-kD thylakoid membrane protein with two putative transmembrane domains that plays an essential role in the assembly of photosystem I (PSI) complexes. It is encoded by the chloroplast genome in eukaryotes and is highly conserved among photosynthetic organisms from cyanobacteria to higher plants . In green algae such as Chlamydomonas reinhardtii, Ycf4 is absolutely essential for PSI assembly, while in cyanobacteria, it functions more as a regulatory factor rather than an essential component . Research has shown that Ycf4 is part of a large complex (>1500 kD) that interacts with newly synthesized PSI polypeptides and assists in the assembly of the PSI complex .

The functional significance of Ycf4 varies between species. In Chlamydomonas reinhardtii and Arabidopsis thaliana, it is essential for PSI accumulation, while in cyanobacteria, mutants deficient in Ycf4 can still assemble PSI complexes, albeit at reduced levels . This indicates evolutionary adaptation of the protein's function across different photosynthetic lineages.

How is Ycf4 organized genetically and what is its genomic context?

In Chlamydomonas reinhardtii, the ycf4 gene is found in the polycistronic transcriptional unit rps9-ycf4-ycf3-rps18 on the chloroplast genome . This genomic organization reflects the coordinated expression of genes involved in chloroplast function and photosystem assembly. The conserved nature of ycf4 across species suggests its fundamental importance in photosynthetic processes, despite variations in its specific role between different organisms.

When studying recombinant Ycf4 from Aegilops speltoides, researchers must consider the genomic context to ensure proper expression constructs. This includes appropriate promoters, transit peptides for chloroplast targeting (if expressed in heterologous systems), and potential regulatory elements.

What methods can be used to tag and purify Ycf4 for biochemical studies?

Tandem affinity purification (TAP) tagging has been successfully employed to isolate and characterize Ycf4-containing complexes. This approach involves:

  • Creating a fusion construct with Ycf4 and a TAP-tag containing calmodulin binding peptide and Protein A domains separated by a tobacco etch virus (TEV) protease cleavage site .

  • Expressing the tagged protein in the appropriate photosynthetic organism.

  • Performing a two-step affinity column chromatography:

    • First adsorption to IgG agarose (utilizing the Protein A domain)

    • TEV protease cleavage to release the bound complex

    • Secondary purification using calmodulin affinity resin

This technique allowed researchers to achieve up to 90% adsorption of Ycf4 to IgG agarose during the first purification step . Importantly, researchers must verify that the TAP-tag does not disrupt the function of Ycf4 by conducting growth assays, fluorescence induction kinetics, and immunoblotting analysis .

How can researchers evaluate the impact of tagging Ycf4 on its normal function?

Before proceeding with purification and characterization studies, it is critical to verify that the addition of tags does not disrupt Ycf4's normal function. Based on established methodologies, researchers should:

  • Perform immunoblot analysis to confirm the expression of the tagged protein at the expected molecular weight (the TAP-tagged Ycf4 shows an increase in size to approximately 44 kD compared to 22 kD for the wild-type protein) .

  • Assess PSI assembly and function through:

    • Fluorescence induction kinetics of dark-adapted cells

    • Growth assays under different light conditions (50-1000 μE·m−2·s−1)

    • Immunoblotting for PSI components

  • Quantify the accumulation level of the tagged protein relative to wild-type levels using techniques such as TEV protease digestion to remove the protein A domain prior to immunoblotting .

In previous studies, TAP-tagged Ycf4 accumulated at approximately 25% of wild-type Ycf4 levels, yet this reduced accumulation did not significantly affect PSI assembly or photosynthetic growth, indicating that Ycf4 is not limiting for PSI assembly .

What techniques are used to identify proteins interacting with Ycf4 in the PSI assembly complex?

The identification of Ycf4-interacting proteins requires multiple complementary approaches:

  • Mass spectrometry (liquid chromatography-tandem mass spectrometry) of purified Ycf4 complexes, which has revealed interactions with:

    • PSI subunits (PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF)

    • Opsin-related COP2 protein

  • Immunoblotting with antibodies against specific PSI components to confirm mass spectrometry results .

  • Sucrose gradient ultracentrifugation followed by ion exchange column chromatography to determine co-purification patterns and establish the exclusivity of protein associations .

  • Pulse-chase protein labeling to determine whether the associated PSI polypeptides are newly synthesized, which helps establish the temporal relationship between Ycf4 interaction and PSI assembly .

The research has shown that almost all Ycf4 and COP2 in wild-type cells copurify through these techniques, indicating their intimate and exclusive association .

What structural approaches can characterize the Ycf4-containing assembly complex?

Structural characterization of the Ycf4-containing complex provides crucial insights into its assembly mechanism. Researchers have employed:

  • Transmission electron microscopy and single particle analysis, which revealed large structures measuring approximately 285 × 185 Å .

  • Biochemical sizing techniques, including:

    • Sucrose gradient ultracentrifugation

    • Size exclusion chromatography

    • Blue native gel electrophoresis

These approaches have demonstrated that the Ycf4-containing complex exceeds 1500 kD in size and may represent several large oligomeric states . By combining structural data with protein interaction information, researchers can begin to model how Ycf4 facilitates the assembly of PSI components.

What considerations are important when designing recombinant Ycf4 expression systems?

When developing recombinant expression systems for Aegilops speltoides Ycf4, researchers should consider:

  • The expression host (bacterial, algal, plant cell cultures) based on research objectives.

  • Chloroplast targeting sequences if expressing in eukaryotic systems.

  • Codon optimization for the expression host.

  • Tag placement to minimize functional disruption:

    • C-terminal tagging has been successfully used without disrupting function

    • N-terminal tagging may interfere with membrane insertion

  • Expression level control, as overexpression might disrupt cellular homeostasis.

The experiences from TAP-tagging experiments in Chlamydomonas reinhardtii provide valuable insight, showing that even when tagged Ycf4 accumulates at only 25% of wild-type levels, PSI assembly can proceed normally .

How does Ycf4 function differ between Aegilops speltoides and other photosynthetic organisms?

While the search results don't specifically address Ycf4 in Aegilops speltoides, comparative analysis between species reveals important functional variations:

  • In green algae (Chlamydomonas reinhardtii) and flowering plants (Arabidopsis thaliana), Ycf4 is essential for PSI accumulation .

  • In cyanobacteria, Ycf4 plays a regulatory role rather than being absolutely essential, as cyanobacterial mutants deficient in Ycf4 can still assemble PSI complexes at reduced levels .

When studying Aegilops speltoides Ycf4, researchers should consider its evolutionary relationship to other plant species, particularly its close relationship to wheat. Given that Aegilops speltoides is considered the progenitor of the B genome in polyploid wheat , comparative studies between Aegilops and Triticum species may reveal functional adaptations of Ycf4 in different cereal crops.

What techniques can be used to study Ycf4 introgression between Aegilops speltoides and wheat?

For studying potential Ycf4 introgression between Aegilops speltoides and wheat, researchers can employ techniques similar to those used for other genes:

  • Sequential fluorescence in situ hybridization (FISH) and genomic in situ hybridization (GISH) to identify chromosome segments containing genes of interest .

  • Molecular markers associated with the gene of interest to track introgression in breeding populations .

  • Expression analysis to confirm functional integrity of the introgressed gene.

  • Phenotypic evaluation to assess the impact of the introgression on photosynthetic efficiency.

The methodologies employed for introgressing Su1-Ph1 from Aegilops speltoides into wheat provide a valuable model for similar work with Ycf4 .

What approaches can be used to study the functional domains of Ycf4?

To elucidate the functional domains of Ycf4, researchers can employ:

  • Site-directed mutagenesis targeting:

    • Conserved residues identified through multi-species alignments

    • Putative transmembrane domains

    • Regions predicted to interact with PSI components

  • Deletion analysis to identify minimal functional regions.

  • Domain swapping between species (e.g., between Aegilops speltoides and cyanobacterial Ycf4) to identify species-specific functional elements.

  • Complementation studies in Ycf4-deficient mutants to assess functional restoration.

  • Protein-protein interaction assays (yeast two-hybrid, split-GFP, co-immunoprecipitation) to map interaction domains with PSI components.

The results from such studies would help establish structure-function relationships for this important assembly factor.

How can researchers quantify the impact of Ycf4 modifications on PSI assembly efficiency?

Quantitative assessment of PSI assembly efficiency following Ycf4 modifications can be performed through:

  • Spectroscopic analysis of PSI activity:

    • P700 oxidation/reduction kinetics

    • Fluorescence induction kinetics in dark-adapted cells

  • Biochemical quantification:

    • Immunoblotting for PSI components

    • Blue native gel electrophoresis to visualize assembled complexes

  • Growth analysis under varying light conditions (as demonstrated with TAP-tagged Ycf4) .

  • Pulse-chase labeling to track the rate of PSI assembly .

These approaches provide complementary data on both the steady-state levels of PSI and the dynamics of its assembly process.

What potential applications exist for modified Ycf4 in crop improvement?

Given Ycf4's role in PSI assembly, potential applications in crop improvement include:

  • Enhancing photosynthetic efficiency through optimized PSI assembly.

  • Improving stress tolerance, as photosystem assembly and repair are critical under environmental stress conditions.

  • Comparative analysis of Ycf4 variants from different species (including Aegilops speltoides) to identify more efficient versions for crop engineering.

When considering such applications, researchers should evaluate the impact on:

What methodologies can be used to introgress beneficial Ycf4 variants from Aegilops speltoides into wheat?

For introgression of potentially beneficial Ycf4 variants from Aegilops speltoides into wheat, researchers can employ approaches similar to those used for Su1-Ph1 introgression:

  • Interspecific hybridization between Aegilops speltoides and wheat.

  • Chromosome manipulation techniques, including:

    • Colchicine treatment to produce amphiploids

    • Backcrossing to introgress specific chromosome segments

  • Molecular marker development to track the Ycf4 gene during breeding:

    • Develop markers specifically linked to Aegilops speltoides Ycf4

    • Use these markers for marker-assisted selection in breeding programs

  • Phenotypic evaluation to confirm improved photosynthetic performance.

  • Sequential FISH and GISH karyotyping to confirm the presence and location of introgressed segments .

The success of such approaches is evidenced by the introgression of Su1-Ph1 from Aegilops speltoides into both hexaploid bread wheat and tetraploid durum wheat .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.