Recombinant Aegilops tauschii Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Introduction

Aegilops tauschii is a wild relative of bread wheat and serves as a valuable genetic resource for crop improvement . Chloroplasts, the organelles responsible for photosynthesis in plants, are bounded by a double membrane called the chloroplast envelope . The inner envelope membrane (IEM) contains various proteins that play crucial roles in chloroplast function . One such protein is the Chloroplast Envelope Membrane protein A (CemA), which is found in Aegilops tauschii . Recombinant CemA refers to the protein produced using recombinant DNA technology, allowing for detailed study and manipulation of its properties .

Basic Information

  • Name: Recombinant Aegilops tauschii Chloroplast Envelope Membrane Protein (cemA)

  • Source Organism: Aegilops tauschii

  • Location: Chloroplast inner envelope membrane

  • Function: The molecular function is currently unknown . CemA proteins are probable integral membrane proteins .

Chloroplast Envelope Membranes and Protein Transport

Chloroplasts are believed to have originated from an endosymbiotic event involving a cyanobacterium . As a result, chloroplasts possess a double membrane envelope inherited from the cyanobacterial ancestor . The biogenesis of the chloroplast envelope involves unique protein sorting mechanisms, distinct from those in cyanobacteria, because most chloroplast proteins are now encoded in the nuclear genome of the host cell .

Subcellular Localization of Related Proteins

Subcellular localization studies of Heavy Metal ATPase (HMA) family proteins in A. tauschii have revealed that certain members, such as AetHMA8, are located in the chloroplast, while others are found in the cell membrane .

Table 1. Physicochemical Properties and Subcellular Localization of AetHMA Proteins in A. tauschii

Gene NameGene IDNo. of aaMW (Da)pIInstability IndexAliphatic IndexGRAVYSubcellular Localization
AetHMA1AET2Gv2091040084591,936.685.8636.2103.830.207Cell membrane
AetHMA2AET5Gv2089500084588,162.026.0147.22100.360.276Cell membrane
AetHMA3AET6Gv2039880067872,819.315.8335.36103.360.312Cell membrane
AetHMA4AET6Gv20415800982105,753.485.436.54101.860.173Cell membrane
AetHMA5AET7Gv2058760049852,501.786.2338.59101.630.294Cell membrane
AetHMA6AET7Gv210170001051114,152.86.7444.3985.56-0.193Cell membrane, nucleus
AetHMA7AET7Gv2101770061966,059.266.6238.9104.30.255Cell membrane
AetHMA8AET7Gv2105770084489,543.317.5136.7599.680.15Chloroplast
AetHMA9AET7Gv211755001018108,744.975.6238.46103.640.294Cell membrane

Experimental Studies on Chloroplast Inner Envelope Membrane Proteins

Experiments involving chimeric bicarbonate transporters in Arabidopsis have provided insights into the targeting and integration of proteins into the chloroplast IEM . These studies have shown that the addition of an IEM targeting signal, along with a transit peptide, can successfully install nuclear-encoded bicarbonate transporters into the chloroplast IEM .

Figure 1. Localization of chimeric BicA and SbtA in chloroplasts

ProteinLocalization
Chimeric BicA (A)Enriched in the envelope fraction; resistant to trypsin treatment, indicating localization to the IEM; partitioned into the soluble fraction when solubilized with 1% Triton X-100; resistant to alkaline extraction, suggesting it is an integral membrane protein at the chloroplast IEM
Chimeric SbtA (B)Similar localization pattern to Chimeric BicA, indicating specific and efficient targeting to the chloroplast IEM
pA-BicA (TEV-treated)Resistant to alkaline extraction, indicating that the BicA portion of the chimeric protein is integrated into the chloroplast IEM and can reside there even after removal of the IEM targeting signal

Redox Activity

Chloroplast envelope membranes exhibit redox activity, indicating the presence of electron transport components . EPR signals at g = 4.3 and around g = 2 have been detected in native envelope membranes, suggesting the presence of enzymatic activities involved in the formation and reduction of semiquinone radicals .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If a specific tag is required, please inform us, and we will prioritize its inclusion.
Synonyms
cemA; ycf10; Chloroplast envelope membrane protein; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa)
Target Names
cemA
Target Protein Sequence
MKKKKALPSLLYLVFIVLLPWGVSSSFNKCLELWIKNWWNTRQSETLLTDIQEKRILERF IELEELSLLDEMIKGKLKTHVQKPPTGIHKEIIQWVKINNEDHLHTILHFSTNIICLAIL SGSFFLGKEELVILNSWVQEFFYNLNDSIKA
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly facilitates efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

How is the cemA gene organized in the chloroplast genome of Aegilops tauschii?

In Aegilops tauschii, the cemA gene is located within the chloroplast genome as part of a gene cluster. Chloroplast genomic studies have revealed that in many plants, cemA is positioned in proximity to other chloroplast genes including psbA, psbI, and atpH genes . The complete chloroplast genome sequencing of seventeen Aegilops tauschii accessions has confirmed this organization .

Unlike many chloroplast genes in vascular plants that are organized into polycistronic transcription units, the transcriptional organization of cemA in Ae. tauschii appears more complex. Research in Chlamydomonas reinhardtii has shown that cemA may be part of polycistronic transcripts, where multiple proteins are encoded from a single mRNA . The gene lacks its own promoter in certain species and is often transcribed as part of di-, tri-, or tetracistronic transcripts.

Why is studying cemA in Aegilops tauschii relevant to wheat improvement?

Aegilops tauschii is the diploid wild progenitor and D genome donor of hexaploid bread wheat (Triticum aestivum) . Studying cemA in this species offers several advantages:

  • Genetic resource for wheat improvement: Ae. tauschii possesses valuable genetic diversity that can be used to improve wheat's resistance to biotic and abiotic stresses, yield parameters, and quality traits .

  • Understanding chloroplast function: As chloroplasts are central to photosynthesis and metabolism, characterizing key envelope proteins like cemA helps elucidate mechanisms affecting plant productivity and stress tolerance.

  • Evolutionary insights: Comparing cemA between Ae. tauschii and modern wheat provides insights into the evolution of chloroplast genes during domestication and breeding.

  • Potential for genetic engineering: Understanding cemA function could inform strategies for improving photosynthetic efficiency in wheat varieties.

The complete chloroplast genomes of seventeen Ae. tauschii accessions have been sequenced, providing valuable information about cpDNA markers that can be used to study intraspecific genetic structure and diversity .

What are the optimal methods for isolating and purifying recombinant cemA protein?

Isolating high-quality recombinant cemA protein requires specialized protocols for membrane proteins:

Expression System Selection:

  • Bacterial systems (E. coli) offer high yield but may struggle with proper folding

  • Plant-based expression systems better reflect native conditions but have lower yields

  • Cell-free systems can be used for toxic or difficult-to-express membrane proteins

Purification Protocol:

  • Cell lysis: Use mild detergents (e.g., n-dodecyl β-D-maltoside) to solubilize membrane proteins

  • Affinity chromatography: Utilize His-tag or other fusion tags for initial purification

  • Size exclusion chromatography: Remove aggregates and increase purity

  • Storage: Maintain in Tris-based buffer with 50% glycerol at -20°C or -80°C

Critical Considerations:

  • Avoid repeated freeze-thaw cycles which can denature the protein

  • Working aliquots should be stored at 4°C for up to one week

  • The hydrophobic nature of cemA requires careful selection of detergents throughout purification

For functional studies, it's essential to verify protein integrity through circular dichroism or other structural analysis methods to ensure the recombinant protein maintains its native conformation.

How can researchers enhance the expression of cemA in heterologous systems?

Enhancing heterologous expression of chloroplast membrane proteins presents several challenges. Based on studies of chloroplast gene expression, researchers can employ the following strategies:

Optimization of Expression Cassettes:

  • Regulatory elements: Incorporate strong promoters and translation control regions (TCRs)

    • Including the 5'-UTR from highly expressed plastid genes like rbcL can significantly increase protein yield

    • The addition of a downstream box (DB) can be essential for protein accumulation

  • Codon optimization: Adjust codons to match the preference of the expression host

  • Fusion partners:

    • N-terminal fusions can improve mRNA stability and protein stability

    • Green fluorescent protein (EGFP) has been successfully used as a reporter for monitoring expression of chloroplast proteins

Expression Parameters Table:

ParameterOptimization StrategyExpected Effect
TemperatureLower to 16-20°CReduced aggregation, improved folding
InductionUse lower IPTG concentrations (0.1-0.5 mM)Slower, more controlled expression
Growth mediaSupplemented with glycerol and specific ionsEnhanced membrane protein integration
Host strainC41(DE3), C43(DE3), or Lemo21(DE3)Strains optimized for membrane protein expression
Co-expressionMolecular chaperones (GroEL/ES)Improved folding

Verification Methods:

  • Western blot analysis using anti-His or specific anti-cemA antibodies

  • Fluorescence microscopy when using reporter fusions

  • Mass spectrometry for protein identification and quantification

Studies on chloroplast transformation in Tetraselmis subcordiformis demonstrated that using endogenous regulators significantly increased transformation efficiency compared to exogenous regulators , suggesting a similar approach might benefit cemA expression.

What methodologies are effective for studying cemA function in chloroplasts?

Understanding cemA function requires a combination of molecular, biochemical, and physiological approaches:

Genetic Approaches:

  • TILLING (Targeting Induced Local Lesions IN Genomes): Ae. tauschii TILLING resources have been developed for reverse genetics . This method allows screening for mutations in cemA to understand its function.

  • CRISPR-Cas9 editing: Although challenging in chloroplasts, plastid transformation with engineered CRISPR systems can create targeted mutations.

  • RNAi or antisense suppression: For species where direct genome editing is difficult.

Functional Analysis Methods:

  • Localization studies:

    • Fluorescent protein tagging

    • Immunogold labeling combined with electron microscopy

    • Subcellular fractionation followed by proteomics

  • Protein interaction studies:

    • Co-immunoprecipitation

    • Yeast two-hybrid assays (for soluble domains)

    • Split-GFP complementation

  • Physiological assessments:

    • Photosynthetic parameter measurements

    • CO₂ uptake and exchange analysis

    • Response to environmental stresses

Proteomics Approach for Chloroplast Envelope Proteins:
Spatial proteomics has proven valuable for analyzing chloroplast envelope proteins. This involves:

  • Isolation of intact chloroplasts

  • Purification of envelope membrane fractions

  • Comparison of protein distribution between total chloroplast lysate and enriched envelope fractions

  • Calculation of enrichment factors to identify genuine envelope proteins

This method has successfully identified previously undetected chloroplast envelope proteins and allowed quantitative comparison between different conditions, such as standard growth versus cold acclimation .

How does cemA expression change during environmental stress conditions?

The chloroplast is central to plant responses to environmental stresses, particularly cold acclimation. While cemA-specific responses haven't been fully characterized, studies on chloroplast envelope proteins provide valuable insights:

Cold Stress Response:
Differential proteome analysis of chloroplast envelope membranes during cold acclimation in Arabidopsis thaliana identified 38 envelope membrane proteins with altered abundance . Though cemA was not specifically highlighted, the study revealed that:

  • Solute carriers showed substantial changes - some increasing (e.g., ATP/ADP antiporter NTT2) and others decreasing (e.g., maltose exporter MEX1) in abundance.

  • Loss-of-function mutations in transporters affected frost recovery, confirming their critical role in cold acclimation .

This suggests that membrane proteins like cemA may play important roles in reconfiguring chloroplast function during stress adaptation.

Drought and Heat Stress:
Aegilops tauschii is known for its tolerance to various abiotic stresses, making it a valuable genetic resource for wheat improvement . The adaptive mechanisms often involve chloroplast function.

Methodological Approach for Stress Response Analysis:
To determine cemA's role in stress responses, researchers should employ:

  • Transcript analysis: qRT-PCR to measure cemA expression under different stress conditions

  • Protein quantification: Western blotting or targeted proteomics

  • Comparative analysis: Contrast cemA behavior in stress-tolerant Ae. tauschii accessions with less tolerant ones

  • Functional assays: Measure photosynthetic parameters in plants with altered cemA expression

What is known about the evolutionary conservation of cemA across Triticeae species?

The cemA gene shows interesting evolutionary patterns within the Triticeae tribe:

Conservation Status:
The cemA gene is conserved across the Triticeae tribe, including in Aegilops tauschii and wheat species. This conservation suggests functional importance.

Structural Features:
Fine-scale analysis of chloroplast genes has revealed that some chloroplast genes can undergo gene conversion with mitochondrial homologs during angiosperm evolution . While no direct evidence exists for cemA, such processes could contribute to its evolution.

Comparative Analysis Approach:
To study cemA evolution:

  • Sequence alignment: Compare cemA sequences across multiple Triticeae species

  • Phylogenetic analysis: Construct trees to understand evolutionary relationships

  • Selection pressure analysis: Calculate dN/dS ratios to detect positive or purifying selection

  • Structural modeling: Predict how sequence variations affect protein structure and function

Genome Integration Patterns:
The chloroplast genomes of flowering plants can occasionally exchange genetic material with mitochondrial genomes. Studies have identified recurrent conversion of short patches of mitochondrial genes by chloroplast homologs during angiosperm evolution . Though cemA wasn't specifically mentioned in these events, such mechanisms could influence its evolution.

How can cemA be used in chloroplast engineering for improved crop performance?

Chloroplast engineering offers several advantages over nuclear transformation, including high-level protein expression and maternal inheritance that limits transgene spread. The cemA gene could be utilized in several ways:

Potential Engineering Approaches:

  • Overexpression strategies:

    • Enhanced expression of native cemA could potentially improve carbon fixation

    • Introduction of cemA variants from stress-tolerant species might confer improved stress tolerance

  • Promoter engineering:

    • Replacing native promoters with inducible or stronger promoters

    • The use of endogenous regulators from highly expressed chloroplast genes (rbcL, psbA) could enhance expression

  • Fusion protein approaches:

    • Creating cemA fusions with other functional domains

    • Using cemA as an anchor for other functional proteins in the chloroplast envelope

Methodological Challenges:

Chloroplast transformation in cereals remains challenging, with several obstacles to overcome:

ChallengePotential Solution
Species-specific protocolsDevelop Aegilops/wheat-specific transformation methods
Expression in non-green plastidsTarget expression to specific tissues or developmental stages
Protein accumulationUse fusion strategies with stable proteins
Pleiotropic effectsEmploy inducible expression systems

Studies in Tetraselmis subcordiformis demonstrated that chloroplast transformation efficiency can be optimized by using endogenous regulators , suggesting similar approaches might work for cemA in wheat species.

Validation Approaches:

  • Phenotypic analysis of transformed plants

  • Physiological measurements of photosynthetic efficiency

  • Stress tolerance assays

  • Field trials under varied environmental conditions

How do cemA sequence variations correlate with phenotypic differences in Aegilops tauschii accessions?

Aegilops tauschii displays considerable genetic diversity across its native range, with accessions classified into three distinct lineages (L1, L2, and L3) . Understanding how cemA sequence variations correlate with phenotypic differences requires:

Comparative Genomics Approach:

  • Sequence analysis across accessions:

    • The complete chloroplast genomes of seventeen Ae. tauschii accessions have been sequenced

    • High-resolution sequence analysis can identify SNPs, insertions/deletions in cemA

  • Structure-function analysis:

    • Mapping variations to protein domains

    • Predicting functional consequences of amino acid substitutions

Correlation with Phenotypic Data:

  • Environmental adaptation:

    • Compare cemA sequences from accessions from different geographic regions

    • Correlate sequence variations with climate data from collection sites

  • Physiological parameters:

    • Photosynthetic efficiency

    • Growth rates

    • Stress tolerance metrics

Experimental Validation:

  • Transformation experiments:

    • Introduce different cemA variants into a common genetic background

    • Measure resulting phenotypic changes

  • TILLING approach:

    • The Ae. tauschii TILLING resource (TILL-D) could be used to identify and characterize mutations in cemA

    • Phenotyping of plants with cemA mutations

Aegilops tauschii accessions show considerable diversity that can be harnessed for wheat improvement , and understanding the role of chloroplast genes like cemA in this diversity could provide valuable insights for crop engineering.

What strategies exist for transferring cemA variants from Aegilops tauschii to cultivated wheat?

Transferring specific cemA variants from Ae. tauschii to wheat requires specialized approaches due to the maternal inheritance of chloroplasts:

Traditional Breeding Approaches:

  • Synthetic hexaploid wheat (SHW) development:

    • Cross tetraploid wheat with Ae. tauschii to create synthetic hexaploids

    • Since chloroplasts are maternally inherited, Ae. tauschii must be used as the female parent to transfer its chloroplast genes

    • This approach requires embryo rescue and chromosome doubling using colchicine

  • Limitations:

    • Chloroplast transmission can only occur when Ae. tauschii is the maternal parent

    • The entire chloroplast genome is transferred, not just the cemA gene

    • Requires verification of chloroplast transmission through molecular markers

Biotechnological Approaches:

  • Chloroplast transformation:

    • Direct transformation of wheat chloroplasts with Ae. tauschii cemA variants

    • Requires species-specific chloroplast transformation protocols

    • Selection markers for transformed chloroplasts (spectinomycin/streptomycin resistance)

  • Expression cassette design:

    • Integration into chloroplast genome requires homologous recombination

    • Flanking sequences must match target integration site

    • Regulatory elements greatly influence expression levels

Verification Methods:

  • Molecular verification:

    • PCR amplification and sequencing of cemA

    • Restriction fragment length polymorphism (RFLP) analysis

    • Chloroplast genome resequencing

  • Functional verification:

    • Transcript analysis (RT-PCR, RNA-seq)

    • Protein analysis (Western blotting)

    • Phenotypic analysis of transformants

How can researchers differentiate between nuclear and chloroplast-encoded versions of cemA in experimental systems?

Distinguishing between nuclear and chloroplast-encoded versions of cemA requires specialized approaches:

Molecular Differentiation Methods:

  • Sequence-based differentiation:

    • Nuclear copies often undergo sequence divergence

    • Design PCR primers targeting sequence differences

    • Restriction enzyme digestion patterns may differ

  • Organelle isolation:

    • Isolate pure chloroplast and nuclear fractions

    • Perform PCR or Southern blotting on fractionated DNA

    • Compare band patterns between fractions

Expression Analysis:

  • Transcript analysis:

    • Chloroplast transcripts lack poly(A) tails

    • Use oligo(dT) selection to separate nuclear (polyadenylated) from chloroplast transcripts

    • Analyze processing patterns (splicing, editing) which differ between compartments

  • Protein analysis:

    • Chloroplast-encoded proteins lack certain post-translational modifications (e.g., glycosylation)

    • Subcellular fractionation followed by Western blotting

    • Mass spectrometry to identify source based on peptide sequences

Functional Verification:

  • Inhibitor studies:

    • Chloroplast translation is sensitive to specific antibiotics (chloramphenicol, spectinomycin)

    • Nuclear translation is sensitive to cycloheximide

    • Differential sensitivity can help distinguish the origin of newly synthesized cemA

  • Genetic approaches:

    • Targeted mutagenesis of chloroplast vs. nuclear genes

    • Complementation studies with compartment-specific expression constructs

Historical studies of gene expression in plastids have shown that accurate attribution of a protein's genomic origin requires multiple lines of evidence .

What are the challenges of studying protein-protein interactions involving cemA in chloroplast membranes?

Studying protein-protein interactions of membrane proteins like cemA presents unique challenges:

Technical Challenges:

  • Hydrophobicity: cemA's transmembrane domains complicate traditional interaction assays

  • Low abundance: Envelope proteins constitute only 0.4% of the whole cell proteome

  • Native conformation: Maintaining proper folding during extraction is difficult

  • Contamination: Cross-contamination during isolation can lead to false positives

Methodological Approaches:

  • In vivo approaches:

    • Split-GFP or BiFC (Bimolecular Fluorescence Complementation)

    • FRET (Fluorescence Resonance Energy Transfer)

    • PLA (Proximity Ligation Assay)

  • In vitro approaches:

    • Co-immunoprecipitation with mild detergents

    • Chemical crosslinking followed by mass spectrometry

    • Liposome reconstitution systems

  • Quantitative proteomics:

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture)

    • Label-free quantitative approaches

    • Spatial proteomics to determine enrichment factors

Data Analysis Considerations:

  • Enrichment calculation: Compare protein abundance in envelope fractions versus total cell extract

  • Statistical validation: Apply strict statistical criteria to identify true interactors

  • Bioinformatic filtering: Use subcellular localization databases to eliminate unlikely interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.