Recombinant Aegilops tauschii Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer requirements.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa)
Target Names
ycf4
Target Protein Sequence
MNWRSEHIWVELLKGSRKRGNFFWACILFLGSLGFLSVGISSYLGKNIISILPSQEILFF PQGVVMSFYGIAGLFISSYLCCTILWNVGSDYDRFDRKEGIVCIFRWEFPGIKRRVFLRF LMRDIQSIRIQVKEGLYPRRILYMEIRGQGIIPLTRTDDQFFTPREIEQKAAELAYFLRV PIEVF
Uniprot No.

Target Background

Function

Appears essential for the assembly of the photosystem I complex.

Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Aegilops tauschii and its genomic significance?

Aegilops tauschii (2n = 2x = 14) is a diploid wild species that has been identified as the donor of the D-genome of cultivated bread wheat. This species represents a valuable genetic resource with extensive diversity based on geographical distribution and contains potentially beneficial genes for cereal breeding, particularly those conferring resistance to fungal diseases like leaf rust and powdery mildew . The genomic significance of Ae. tauschii extends beyond its contribution to bread wheat, as it exhibits considerable chromosomal organization differences between accessions from diverse geographical origins, creating a reservoir of genetic variation for crop improvement .

What is the function of Ycf4 in photosystem I assembly?

Ycf4 is a thylakoid membrane protein that functions as an essential assembly factor for photosystem I (PSI) complexes. In photosynthetic organisms like Chlamydomonas reinhardtii, Ycf4 has been demonstrated to be critical for the accumulation of functional PSI . Biochemical studies have revealed that Ycf4 forms a large stable complex exceeding 1500 kD that contains PSI subunits including PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF . This complex appears to serve as a platform for the assembly of newly synthesized PSI polypeptides. Pulse-chase protein labeling experiments have confirmed that PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and represent a partially assembled intermediate in the PSI biogenesis pathway .

How are Ycf4 complexes isolated and characterized?

The isolation of Ycf4-containing complexes can be achieved using tandem affinity purification (TAP) tagging methods. In previous studies, C-terminal TAP-tagged Ycf4 has been used effectively without significantly affecting protein function or structure . The purification protocol typically involves:

  • Solubilization of thylakoid membranes with dodecyl maltoside (DDM)

  • Adsorption of TAP-tagged Ycf4 to IgG agarose columns (overnight incubation at 4°C for optimal binding)

  • Elution and further purification

When properly executed, this approach can achieve approximately 90% adsorption efficiency of Ycf4 from thylakoid extracts . Characterization of the purified complexes can be performed using transmission electron microscopy and single particle analysis, which have revealed particles measuring up to 285 × 185 Å . Additional characterization typically includes mass spectrometry (LC-MS/MS) and immunoblotting to identify associated proteins.

How does Ycf4 structure and function vary among Aegilops tauschii accessions?

The structure and function of Ycf4 across different Ae. tauschii accessions may exhibit variation that correlates with geographical origin and chloroplast genome diversity. Table 1 presents comparative data on chloroplast genome characteristics from 17 Ae. tauschii accessions that may influence Ycf4 expression and function:

AccessionOriginGenome Size (bp)GC%Gene Density (genes per kb)Gene/Genome (%)
AY21Tajikistan135,85838.320.6143.9
AY22Pakistan136,00938.310.6143.9
AY320Turkey135,97838.330.6143.8
SC1China135,60838.330.61244.0
XJ04China135,61038.330.6143.3
AS060Iran135,63438.320.61144.0
AY78Afghanistan135,65638.320.61144.0

Research examining Ycf4 across these accessions should consider how slight variations in chloroplast genome structure might influence photosystem assembly efficiency, particularly in relation to environmental adaptations specific to the geographical origins . The genetic diversity observed among accessions suggests that Ycf4 functionality may be optimized differently in response to local selective pressures affecting photosynthetic performance.

What methodological approaches are optimal for expressing recombinant Ycf4 from Aegilops tauschii?

For successful recombinant expression of Ae. tauschii Ycf4, researchers should implement a multi-faceted approach considering the protein's membrane-associated nature. Recommended methodological strategies include:

  • Vector selection: Expression vectors containing strong inducible promoters (T7, trc) with fusion tags for purification and detection (His, GST, or TAP tag systems)

  • Expression systems optimization: Comparison between prokaryotic (E. coli) and eukaryotic (yeast, insect cells) hosts to determine optimal folding and stability

  • Solubilization protocols: Testing various detergents (DDM, β-OG, digitonin) at different concentrations to maintain protein stability while efficiently extracting from membranes

  • Purification strategy: Implementation of two-phase purification employing affinity chromatography followed by size exclusion or ion exchange chromatography

Particular attention should be paid to preserving the native protein structure through careful selection of buffer conditions, including pH (typically 7.0-8.0), salt concentration (150-300 mM NaCl), and stabilizing agents like glycerol (10-15%) . For functional studies, co-expression with interacting partners from PSI may enhance stability and provide insight into complex formation capacity.

How can researchers analyze the interaction between Ycf4 and PSI assembly components?

Analyzing interactions between recombinant Ae. tauschii Ycf4 and PSI components requires a combination of biochemical, biophysical, and imaging techniques. An effective methodological framework includes:

  • Co-immunoprecipitation assays using anti-Ycf4 antibodies to pull down interacting PSI subunits, followed by immunoblotting with antibodies against PSI components (PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF)

  • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to determine binding kinetics and thermodynamics

  • Yeast two-hybrid or split-GFP assays to confirm direct protein-protein interactions

  • Cryo-electron microscopy of purified complexes to visualize the structural arrangement similar to the 285 × 185 Å particles previously observed

  • Native gel electrophoresis combined with second-dimension SDS-PAGE to resolve complex components

Additionally, pulse-chase labeling experiments with radioactive amino acids can track the incorporation of newly synthesized PSI subunits into Ycf4-containing complexes, providing temporal information about the assembly process . Cross-linking studies using chemical cross-linkers of varying lengths can identify specific interaction domains between Ycf4 and its binding partners.

How does the geographical origin of Aegilops tauschii affect Ycf4 sequence conservation?

The geographical distribution of Ae. tauschii accessions appears to correlate with genetic diversity observed in chloroplast genomes, which may extend to the ycf4 gene. Accessions from China (SC1, XJ04, XJ098, XJ0109, T093) form a relatively homogeneous group distinct from accessions of western Asian origin (Turkey, Iran, Afghanistan, Tajikistan) . This geographical clustering suggests distinct evolutionary trajectories that may have influenced Ycf4 functionality.

Fluorescence in situ hybridization (FISH) patterns revealed by repetitive sequence analysis demonstrate region-specific chromosomal variations among Ae. tauschii accessions . While these patterns primarily reflect nuclear genome organization, they indicate the potential for similar diversity in chloroplast-encoded genes like ycf4. The most pronounced differences were observed in Chinese accessions, which exhibited distinct hybridization signal patterns compared to western Asian accessions .

What correlations exist between Ycf4 variations and photosynthetic adaptation in different environments?

Researchers investigating correlations between Ycf4 variations and photosynthetic adaptation should consider several methodological approaches:

  • Comparative sequence analysis of the ycf4 gene across accessions from environments with varying light intensity, temperature ranges, and water availability

  • Measurement of photosynthetic efficiency parameters (quantum yield, electron transport rate) in accessions with different Ycf4 variants

  • Environmental chamber experiments testing photosynthetic performance under controlled stress conditions

  • Complementation studies introducing Ycf4 variants into model organisms with ycf4 deletions to assess functional conservation

The analysis should account for elevation differences between collection sites (ranging from 30 m in Izmir, Turkey to 1,275 m in Kars, Turkey) , as these represent distinct selective pressures on photosynthetic machinery. Notably, higher elevation sites experience increased UV radiation and temperature fluctuations that may have driven adaptive changes in photosystem assembly efficiency.

How can CRISPR-Cas9 be used to study Ycf4 function in Aegilops tauschii?

Designing CRISPR-Cas9 experiments to study Ycf4 function in Ae. tauschii requires specialized approaches for chloroplast genome editing. The recommended methodology includes:

  • Targeting strategy development:

    • Design sgRNAs targeting conserved regions of the ycf4 gene

    • Incorporate chloroplast-targeting sequences to ensure Cas9 localization to chloroplasts

    • Create truncation, domain deletion, and point mutation variants to assess structure-function relationships

  • Transformation protocol optimization:

    • Biolistic transformation of embryogenic callus tissue

    • Selection of transformants using spectinomycin resistance markers

    • Confirmation of homoplasmy through repeated selection cycles

  • Phenotypic analysis framework:

    • Chlorophyll fluorescence measurements (Fv/Fm, NPQ, ETR)

    • Thylakoid membrane protein analysis by Blue-Native PAGE

    • PSI activity assays measuring P700 oxidation kinetics

    • Growth measurements under varying light conditions

  • Complementation studies:

    • Re-introduction of wild-type and mutant ycf4 variants

    • Cross-species complementation to assess functional conservation

When implementing this approach, researchers should be aware that achieving homoplasmy (complete replacement of all chloroplast genome copies) is essential for observing clear phenotypes, as the high copy number of chloroplast genomes can mask partial editing effects.

What analytical techniques are most effective for characterizing Ycf4-PSI assembly intermediates?

For comprehensive characterization of Ycf4-PSI assembly intermediates, researchers should employ a multi-technique approach:

  • Separation techniques:

    • Sucrose gradient ultracentrifugation to isolate complexes based on size

    • Ion exchange chromatography to separate based on charge properties

    • Blue-Native PAGE to preserve native protein complexes

  • Composition analysis:

    • LC-MS/MS proteomics to identify all protein components

    • Immunoblotting with specific antibodies against PSI subunits

    • N-terminal sequencing to confirm protein identities

  • Structural analysis:

    • Negative stain electron microscopy for initial visualization

    • Cryo-EM for high-resolution structural determination

    • Single particle analysis to identify different assembly states

  • Functional assessment:

    • Spectroscopic analysis of chlorophyll and carotenoid content

    • P700 oxidation measurements to assess PSI activity

    • Time-resolved fluorescence to examine energy transfer efficiency

This methodological framework has successfully identified Ycf4-containing complexes of >1500 kD that contain PSI subunits and appear to represent assembly intermediates . The visualization of particles measuring 285 × 185 Å by electron microscopy provides important structural context for understanding the assembly platform function of Ycf4 .

How can contradictory findings about Ycf4 function be reconciled across different experimental systems?

Researchers encountering contradictory findings about Ycf4 function across experimental systems should consider several methodological approaches to reconciliation:

  • System-specific differences analysis:

    • Compare Ycf4 essentiality in Chlamydomonas (where it is absolutely required for PSI accumulation) versus cyanobacteria (where mutants can still assemble PSI, albeit at reduced levels)

    • Examine protein sequence conservation to identify system-specific domains that may explain functional differences

    • Conduct heterologous expression experiments to test cross-species complementation efficiency

  • Experimental condition evaluation:

    • Systematically vary light intensity, quality, and photoperiod across experimental systems

    • Control for developmental stage differences that may affect interpretation

    • Standardize protein extraction and complex isolation protocols

  • Quantitative assessment approach:

    • Establish clear metrics for PSI assembly efficiency (% of wild-type PSI levels)

    • Employ absolute quantification methods rather than relative comparisons

    • Use multiple independent methods to measure the same parameters

  • Meta-analysis framework:

    • Compile findings across species with standardized effect size calculations

    • Weight evidence based on methodological rigor and reproducibility

    • Identify environmental or genetic factors that correlate with functional variations

This systematic approach recognizes that apparent contradictions may reflect real biological differences in Ycf4 function across evolutionary lineages rather than experimental artifacts, potentially revealing important insights about photosystem assembly pathway evolution.

What bioinformatic approaches best reveal structure-function relationships in Ycf4 across Triticeae species?

Optimal bioinformatic approaches for analyzing Ycf4 structure-function relationships across Triticeae species should include:

  • Sequence analysis methods:

    • Multiple sequence alignment of Ycf4 from diverse Triticeae members

    • Calculation of conservation scores at each amino acid position

    • Identification of species-specific and clade-specific variations

  • Structural prediction protocols:

    • Ab initio and homology-based protein structure modeling

    • Molecular dynamics simulations to assess structural stability

    • Protein-protein docking with PSI components to predict interaction interfaces

  • Evolutionary analysis techniques:

    • Phylogenetic reconstruction to establish evolutionary relationships

    • Selection pressure analysis (dN/dS ratios) to identify positions under selection

    • Ancestral sequence reconstruction to trace functional changes

  • Integrative approaches:

    • Correlation of sequence variations with chloroplast genome characteristics

    • Mapping of variations to predicted functional domains

    • Network analysis of co-evolving positions within Ycf4 and between Ycf4 and its interaction partners

The comparative analysis of complete chloroplast genomes from 17 Ae. tauschii accessions provides a valuable foundation for these bioinformatic approaches, as it establishes the genomic context for ycf4 gene evolution . The geographical clustering of genetic variations suggests regional adaptations that may manifest in functional differences of the Ycf4 protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.