Recombinant Aerobic respiration control sensor protein ArcB (arcB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Aerobic Respiration Control Sensor Protein ArcB

The Recombinant Aerobic Respiration Control Sensor Protein ArcB, often referred to as ArcB, is a crucial component of the Arc two-component system in bacteria such as Escherichia coli. This system plays a pivotal role in regulating gene expression in response to changes in respiratory conditions, particularly under anoxic or reducing environments . ArcB acts as a sensor kinase, detecting alterations in the cellular redox state and initiating a signaling cascade that ultimately modulates transcription through its interaction with the response regulator ArcA .

Structure and Function of ArcB

ArcB is a complex, membrane-bound protein with multiple cytoplasmic domains. It includes an N-terminal transmitter domain, a central receiver domain, and a C-terminal alternative transmitter domain . These domains are crucial for the autophosphorylation and subsequent transphosphorylation of ArcA. The autophosphorylation process is typically intramolecular, differing from the more common intermolecular autophosphorylation seen in other histidine kinases .

DomainFunctionKey Residues
N-terminal Transmitter Domain (H1)Autophosphorylation siteHis292
Central Receiver Domain (D1)Phosphoryl group transferAsp576
C-terminal Alternative Transmitter Domain (H2)Phosphoryl group transfer to ArcAHis717

Role in Cellular Processes

ArcB is primarily known for its role in sensing anaerobic conditions, but recent studies suggest it is also active under aerobic conditions, responding to the rate of oxygen consumption rather than just oxygen availability . This system interacts with other regulatory pathways, such as the fumarate and nitrate reductase regulator (FNR), to modulate metabolic processes . The Arc system influences various cellular activities, including central metabolism, acid tolerance, biofilm formation, and infection processes .

Recombinant Production of ArcB

Recombinant ArcB proteins are produced in various hosts, including E. coli, yeast, baculovirus, and mammalian cells . These proteins are typically purified to a high degree (>85% purity) using SDS-PAGE . Recombinant ArcB is used in research to study the mechanisms of two-component signaling systems and to explore potential applications in biotechnology and medicine.

Research Findings and Applications

Research on ArcB has provided insights into the complex regulation of bacterial metabolism and redox balance. The protein's role in sensing oxygen consumption rates makes it a valuable target for studying how bacteria adapt to different environments . Additionally, understanding the Arc system can inform strategies for controlling bacterial infections and developing novel therapeutic approaches .

References:

  1. In vitro phosphorylation study of the Arc two-component signal transduction system. PubMed.

  2. The ArcB Sensor Kinase of Escherichia coli Autophosphorylates by an Intramolecular Reaction. PMC.

  3. The ArcAB Two-Component System: Function in Metabolism, Redox Control, and Infection. PMC.

  4. The ArcB sensor kinase of Escherichia coli: genetic analysis of signal transduction. PubMed.

  5. ArcB recombinant protein products. MyBioSource.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
arcB; Z4574; ECs4089; Aerobic respiration control sensor protein ArcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-778
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
arcB
Target Protein Sequence
MKQIRLLAQYYVDLMMKLGLVRFSMLLALALVVLAIVVQMAVTMVLHGQVESIDVIRSIF FGLLITPWAVYFLSVVVEQLEESRQRLSRLVQKLEEMRERDLSLNVQLKDNIAQLNQEIA VREKAEAELQETFGQLKIEIKEREETQIQLEQQSSFLRSFLDASPDLVFYRNEDKEFSGC NRAMELLTGKSEKQLVHLKPADVYSPEAAAKVIETDEKVFRHNVSLTYEQWLDYPDGRKA CFEIRKVPYYDRVGKRHGLMGFGRDITERKRYQDALERASRDKTTFISTISHELRTPLNG IVGLSRILLDTELTAEQEKYLKTIHVSAVTLGNIFNDIIDMDKMERRKVQLDNQPVDFTS FLADLENLSALQAQQKGLRFNLEPTLPLPHQVITDGTRLRQILWNLISNAVKFTQQGQVT VRVRYDEGDMLHFEVEDSGIGIPQDELDKIFAMYYQVKDSHGGKPATGTGIGLAVSRRLA KNMGGDITVTSEQGKGSTFTLTIHAPSVAEEVDDAFDEDDMPLPALNVLLVEDIELNVIV ARSVLEKLGNSVDVAMTGKAALEMFKPGEYDLVLLDIQLPDMTGLDISRELTKRYPREDL PPLVALTANVLKDKQEYLNAGMDDVLSKPLSVPALTAMIKKFWDTQDDEESTVTTEENSK SEALLDIPMLEQYLELVGPKLITDGLAVFEKMMPGYVNVLESNLTAQDKKGIVEEGHKIK GAAGSVGLRHLQQLGQQIQSPDLPAWEDNVGEWIEEMKEEWRHDVEVLKAWVAKATKK
Uniprot No.

Target Background

Function
Recombinant Aerobic Respiration Control Sensor Protein ArcB (arcB) is a member of the two-component regulatory system ArcB/ArcA. It functions as a sensor-regulator protein for anaerobic repression of the arc modulon, activating ArcA through a four-step phosphorelay mechanism. ArcB also possesses the ability to dephosphorylate ArcA via a reverse phosphorelay involving His-717 and Asp-576.
Database Links

KEGG: ece:Z4574

STRING: 155864.Z4574

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ArcB protein and what is its primary function?

ArcB is a sensor kinase component of the ArcAB two-component regulatory system found in facultatively anaerobic bacteria. Its primary function involves sensing the modulation of oxygen availability and consumption rate, rather than directly measuring dissolved oxygen concentrations. ArcB initiates a phosphorelay system that ultimately activates the response regulator ArcA, which then regulates gene expression to adapt cellular metabolism based on respiratory conditions. The system mediates the switch from aerobic respiration to fermentation or anaerobic respiration when oxygen consumption decreases .

How does ArcB differ from canonical sensor kinases?

Unlike canonical sensor kinases, ArcB has an atypical configuration that contributes to its specialized function. ArcB possesses two transmembrane helices that function solely as membrane anchors, connected by a conspicuously short periplasmic domain of only 16 amino acids. While many sensor kinases have complex periplasmic domains that directly interact with external stimuli, ArcB's periplasmic bridge has been shown not to be involved in signaling, indicating that ArcB requires interactions with adaptor molecules to ultimately sense stimuli. Furthermore, ArcB is a tripartite sensor kinase with two additional domains beyond the canonical single domain with an invariant histidine residue for autophosphorylation. These additional domains contain an extra histidine residue and an aspartate residue that participate in the phosphorylation process .

What is the relationship between ArcB and the bacterial quinone pool?

The bacterial quinone pool serves as the primary modulator of ArcAB activity. Quinones and their oxidation states play a crucial role in activating and deactivating ArcB, though questions remain about the exact regulatory mechanism. In aerobic conditions, oxidized quinones inhibit ArcB activity, while in anaerobic conditions, reduced quinones promote ArcB activation. This interaction allows bacteria to sense respiratory status and adjust metabolic pathways accordingly .

What evidence supports ArcB function under aerobic conditions despite its traditional characterization as an anaerobic sensor?

Recent research has challenged the long-standing characterization of the ArcAB system as strictly an anaerobic global regulator. Several studies have reported phenotypes for ArcAB mutants under higher-oxygen conditions, establishing that ArcAB is responsive to more than oxygen availability alone. In strains where genes encoding terminal oxidases are removed, ArcA becomes activated even in aerobic conditions due to the cell's inability to utilize oxygen as a terminal electron acceptor. This suggests that ArcB more accurately senses the oxygen consumption rate or the degree to which bacteria acquire and utilize oxygen, rather than simply dissolved oxygen concentrations. This distinction becomes important when considering contexts where oxygen consumption may decrease even when abundant oxygen is available. Some researchers have further described ArcAB as a general redox sensor rather than specifically an oxygen sensor .

How do competing models explain the regulatory mechanism of ArcB activation and deactivation?

Multiple competing models exist to explain the precise mechanism by which quinones regulate ArcB activity. The primary models include:

  • Direct Interaction Model: This model proposes that quinones directly bind to specific domains of ArcB, causing conformational changes that either promote or inhibit its kinase activity.

  • Redox Switch Model: This model suggests that the oxidation state of key cysteine residues in ArcB's PAS domain forms a redox switch that is influenced by the quinone pool's oxidation state, thereby controlling ArcB activity.

  • Membrane Potential Model: This alternative model proposes that changes in membrane potential resulting from shifts in respiratory conditions indirectly affect ArcB conformation and activity.

Research continues to weigh these competing explanations, with recent evidence suggesting that a combination of direct quinone interaction and the redox state of specific cysteine residues likely regulates ArcB function .

What role does ArcB play in bacterial pathogenesis and host-pathogen interactions?

ArcB's role in sensing respiratory conditions makes it particularly important during infection, as pathogens must adapt to varying oxygen availabilities within host tissues. The ArcAB system regulates various virulence factors in different bacterial pathogens, including biofilm formation, toxin production, and resistance to host immune defenses. Additionally, the metabolic adaptation governed by ArcB allows pathogens to utilize alternative energy sources when oxygen is limited in infection sites. In some pathogens, mutations in arcB have been shown to attenuate virulence, highlighting its importance in pathogenesis. The system may also influence how bacteria respond to oxidative stress generated by host immune cells during infection .

What are the most effective approaches for creating recombinant ArcB constructs for functional studies?

For functional studies of recombinant ArcB, researchers should consider the following methodological approach:

  • Vector Selection: Choose expression vectors with appropriate promoters for controlled expression in the target organism. For bacterial expression, pET vectors or similar systems with inducible promoters are often effective.

  • Domain Preservation: When designing recombinant ArcB constructs, it's crucial to maintain the integrity of all three phosphorylation domains (H1, D1, and H2) as well as the transmembrane regions to ensure proper membrane localization and function.

  • Tagging Strategy: For purification and detection purposes, add affinity tags (His, FLAG, etc.) at positions least likely to interfere with ArcB function. C-terminal tagging is often preferred as it generally preserves N-terminal membrane insertion.

  • Expression System: For in vitro biochemical studies, E. coli expression systems work well, while arcB knockout strains are preferable for complementation studies to avoid interference from endogenous ArcB.

  • Verification Methods: Confirmation of proper expression and localization should include Western blotting, membrane fractionation, and functional assays measuring autophosphorylation activity.

For site-directed mutagenesis studies, focus on conserved residues in the phosphorylation sites (His292, Asp576, and His717) and the cysteine residues potentially involved in redox sensing .

What experimental designs are most appropriate for studying ArcB's role in oxygen sensing?

When investigating ArcB's oxygen-sensing capabilities, researchers should implement the following experimental designs:

  • Controlled Oxygen Gradient Studies: Use specialized chambers with precise oxygen control to expose bacteria expressing wild-type or mutant ArcB to defined oxygen concentrations, ranging from fully aerobic to anaerobic conditions.

  • Real-time Monitoring Approaches: Couple oxygen consumption rate measurements with simultaneous assessment of ArcB phosphorylation status or ArcA-regulated gene expression using reporter constructs.

  • True Experimental Design with Controls: Implement a pretest-posttest control group design (Design 4 from Campbell & Stanley) or a Solomon four-group design (Design 5) to account for confounding variables when testing ArcB function across different oxygen conditions .

  • Quinone Manipulation Experiments: Supplement bacteria with different quinone types or inhibit quinone synthesis to assess their direct impact on ArcB activation.

  • In vivo Phosphorylation Assays: Utilize Phos-tag gel electrophoresis or similar techniques to quantify ArcB phosphorylation levels under different respiratory conditions.

This multi-faceted approach allows for robust determination of ArcB's sensing mechanisms while controlling for potential confounding variables such as growth phase effects or metabolic byproducts .

What methodological approaches can be used to study ArcB-quinone interactions?

To investigate the critical interactions between ArcB and the bacterial quinone pool, researchers can employ several complementary methodological approaches:

  • In vitro Reconstitution Systems: Purify recombinant ArcB protein and reconstitute it in liposomes containing defined quinone compositions to study direct interactions.

  • Site-Directed Mutagenesis: Create targeted mutations in predicted quinone-binding regions of ArcB and assess changes in quinone sensitivity.

  • Crosslinking Studies: Implement photo-activatable or chemical crosslinking approaches with modified quinones to identify specific interaction sites on ArcB.

  • Structural Biology Techniques: Use X-ray crystallography or cryo-electron microscopy to determine the structure of ArcB in complex with different quinones.

  • Quantitative Binding Assays: Employ isothermal titration calorimetry (ITC), surface plasmon resonance (SPR), or fluorescence-based techniques to measure binding affinities between purified ArcB and various quinones.

  • Computational Modeling: Utilize molecular docking and simulation approaches to predict and validate quinone binding sites on ArcB.

  • Quinone-Deficient Strains: Generate bacterial strains with deficiencies in specific quinone biosynthesis pathways to determine which quinone types are most critical for ArcB regulation .

How should researchers address potential statistical regression effects when analyzing ArcB phenotypes?

  • Implement True Experimental Designs: Use designs with randomized control groups (such as Design 4: Pretest-Posttest Control Group Design) to distinguish genuine effects from regression artifacts.

  • Account for Selection Biases: Be particularly cautious when selecting experimental groups based on extreme values of any measurement. For example, if selecting bacterial cultures with extremely high or low ArcB activity for further study, regression toward the mean is expected regardless of treatment.

  • Apply Appropriate Statistical Controls: Use ANCOVA (Analysis of Covariance) when analyzing data where pretest measures might influence posttest outcomes.

  • Perform Power Analysis: Conduct a priori power analysis to determine adequate sample sizes needed to detect true effects while accounting for regression phenomena.

  • Consider Multiple Measurements: Instead of relying on single measurements, take multiple measurements before and after interventions to establish more reliable baselines and outcomes.

What are the recommended approaches for analyzing contradictory data in ArcB research?

When facing contradictory results in ArcB research, which is common given the complexity of bacterial regulatory systems, researchers should employ the following analytical approaches:

How can researchers effectively interpret ArcB phosphorylation data in the context of quinone pool dynamics?

Interpreting ArcB phosphorylation data in relation to quinone pool dynamics requires sophisticated analytical approaches due to the complex interplay between these systems. Researchers should:

How is recombinant ArcB technology being utilized in vaccine development platforms?

The principles underlying recombinant bacterial protein expression systems, including those used for ArcB studies, are being adapted for vaccine development platforms. While ArcB itself is not typically a vaccine antigen, the methodologies for creating recombinant bacterial strains have relevant applications:

  • Bacterial Vector Platforms: Similar to how researchers create recombinant ArcB constructs, scientists are developing recombinant BCG (rBCG) strains expressing viral antigens as vaccine candidates. For example, rBCG expressing SARS-CoV-2 chimeric proteins (rBCG-ChD6) has shown promising results in providing protection against viral challenge in K18-hACE2 mice.

  • Adjuvant Properties: BCG's inherent immunostimulatory properties, which involve bacterial sensing systems conceptually similar to ArcAB, can be leveraged as adjuvant-like tools to elicit strong cellular and humoral immune responses against heterologous antigens.

  • Dual Benefit Approach: Recombinant bacterial vaccines can potentially provide both the beneficial trained immunity effects of the bacterial vector and specific immune responses against target antigens, similar to how ArcB serves dual sensing functions.

  • Stable Expression Systems: The technology for stable and controlled expression of foreign antigens in bacterial vectors has been investigated with promising results for viral, bacterial, and parasitic proteins, building on expression system technology used in fundamental research on proteins like ArcB .

What role does ArcB research play in understanding bacterial adaptation during infection?

ArcB research provides critical insights into bacterial adaptation mechanisms during infection, particularly regarding metabolic shifts in response to changing oxygen availability in host environments:

  • Microaerobic Host Niches: Many infection sites present microaerobic conditions similar to those that activate ArcB, making this system relevant for understanding bacterial adaptation within the host.

  • Metabolic Reprogramming: ArcB-mediated metabolic shifts allow pathogens to adapt to reduced oxygen availability by adjusting central carbon metabolism, activating fermentation pathways, and optimizing energy generation.

  • Virulence Regulation: In several pathogens, the ArcAB system directly or indirectly regulates virulence factor expression, connecting metabolic adaptation to pathogenesis.

  • Biofilm Formation: ArcB regulation influences biofilm development in several bacterial species, contributing to persistence and antibiotic tolerance during infection.

  • Host Immune Evasion: Some bacteria utilize ArcB-dependent metabolic adaptations to evade host immune responses, particularly those related to reactive oxygen species.

Understanding these aspects of ArcB function provides potential targets for therapeutic intervention that could disrupt bacterial adaptation during infection without directly targeting essential functions, potentially reducing selective pressure for resistance development .

Table 1: Structural and Functional Domains of ArcB Protein

DomainPositionFunctionKey Residues
Transmembrane Domain 122-42Membrane anchoringHydrophobic residues
Periplasmic Domain43-58Connects transmembrane regions; not involved in signaling16 amino acids total
Transmembrane Domain 259-79Membrane anchoringHydrophobic residues
PAS Domain80-166Potential quinone interaction siteCys180, Cys241
H1 Domain267-322Primary autophosphorylationHis292 (phosphorylation site)
D1 Domain533-640Receiver domain for phosphotransferAsp576 (phosphorylation site)
H2 Domain673-778Secondary phosphorylation domain for transfer to ArcAHis717 (phosphorylation site)

Table 2: Experimental Approaches for Studying ArcB Function

Research QuestionRecommended MethodologyKey ControlsData Analysis Approach
ArcB-Quinone InteractionIn vitro reconstitution with purified componentsNon-phosphorylatable ArcB mutantsDirect binding kinetics analysis
Oxygen Sensing MechanismControlled oxygen gradient experimentsarcB deletion strain complementationTime-course phosphorylation state analysis
ArcB Activation KineticsPhos-tag gel electrophoresisConstitutively active ArcB mutantsFirst-order reaction kinetics modeling
Recombinant ArcB ExpressionMembrane-targeted expression systemsEmpty vector controlsWestern blot quantification with standard curves
In vivo ArcB FunctionReporter fusions to ArcA-regulated promotersArcA and ArcB knockout controlsNormalized reporter activity analysis

Table 3: Comparison of ArcB Activation Models

ModelKey MechanismSupporting EvidenceLimitations
Direct Quinone BindingQuinones directly interact with ArcB domainsIn vitro binding studies; structural predictionsLimited structural confirmation of binding sites
Cysteine Redox SwitchCysteine residues form disulfide bonds based on quinone redox stateMutational analysis of cysteine residues shows altered activityIndirect evidence; potential for multiple regulatory mechanisms
Indirect SensingMembrane properties altered by respiratory status affect ArcB conformationChanges in ArcB activity with membrane composition alterationsDifficult to separate from direct quinone effects
Integrated ModelCombines direct quinone interaction with redox-sensitive cysteine regulationComprehensive explanation for multiple experimental observationsComplex model requiring further validation

What emerging techniques might advance our understanding of ArcB structure-function relationships?

Several cutting-edge technologies show promise for resolving persistent questions about ArcB structure-function relationships:

  • Cryo-Electron Microscopy: This rapidly advancing technique could help determine the full-length structure of membrane-embedded ArcB, particularly focusing on conformational changes during activation.

  • Single-Molecule Techniques: Methods such as single-molecule FRET could track real-time conformational changes in ArcB under different redox conditions, providing insights into activation dynamics.

  • Advanced Mass Spectrometry: Hydrogen-deuterium exchange mass spectrometry and cross-linking mass spectrometry could identify regions of ArcB that interact with quinones or undergo conformational changes during activation.

  • In-Cell NMR: This emerging technique could potentially monitor ArcB structural changes directly within living bacterial cells under different respiratory conditions.

  • Integrative Structural Biology: Combining multiple structural techniques with computational modeling could build comprehensive structural models of the entire ArcAB signaling pathway.

These methodological advances would address current knowledge gaps regarding how ArcB transmits signals across the membrane and coordinates its tripartite phosphorylation cascade .

How can quantitative systems biology approaches enhance ArcB research?

Quantitative systems biology approaches offer powerful frameworks for understanding ArcB within its complex regulatory network:

  • Network Reconstruction: Comprehensive mapping of all interactions between ArcAB and other regulatory systems would provide context for interpreting ArcB function.

  • Metabolic Flux Analysis: Techniques such as 13C metabolic flux analysis could quantify how ArcB activation alters carbon flow through central metabolism under different respiratory conditions.

  • Stochastic Modeling: Development of stochastic models incorporating cell-to-cell variability in ArcB activity could explain heterogeneous bacterial population responses to oxygen fluctuations.

  • Multi-Scale Modeling: Creating models that integrate molecular interactions with cellular physiology and population dynamics would connect ArcB mechanisms to broader bacterial behaviors.

  • Machine Learning Approaches: Application of machine learning to large-scale -omics datasets could identify previously unrecognized patterns in ArcB-dependent gene regulation and metabolic adaptation.

These systems-level approaches would complement traditional molecular and biochemical studies by placing ArcB within its broader physiological context and enabling predictive understanding of bacterial respiratory adaptation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.