Recombinant Aeromonas hydrophila subsp. hydrophila ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly include this information in your order notes. We will prepare your order according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributor.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Avoid repeated freezing and thawing. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the product for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
atpB; AHA_4268; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-260
Protein Length
full length protein
Species
Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240)
Target Names
atpB
Target Protein Sequence
MSATGEVLTPQGYISHHLTHLQVGSGFWTVNIDSMIFSVLLGALFIWSFRRVAVKATSGV PGKLQCFVEMLVEFVSGNVKDIFHGRNKVIAPLGLTVFVWIFLMNLMDLIPVDFIPHAAQ LMGVPYLRVVPSADVNITMSMALGVFFLILYYSIKVKGIGGFVKELTLQPFNHPAAIPVN LILETVTLISKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILSVPWAIFHILIITLQ AFIFMVLTIVYLSMAQEDHG
Uniprot No.

Target Background

Function
As a key component of the proton channel, this protein plays a direct role in facilitating proton translocation across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of ATP synthase subunit a (atpB) in Aeromonas hydrophila?

ATP synthase subunit a is a critical membrane-embedded component of the F₀ portion of the ATP synthase complex in A. hydrophila. This protein plays an essential role in proton translocation across the membrane, which drives the synthesis of ATP from ADP and inorganic phosphate. In A. hydrophila, as a ubiquitous waterborne bacterium with broad metabolic capabilities, ATP synthase is particularly important for energy production under various environmental conditions . The atpB gene encodes this subunit and contributes to the organism's ability to flourish in both aquatic environments and potential host organisms.

How does the ATP synthase complex relate to other metabolic systems in A. hydrophila?

The ATP synthase complex in A. hydrophila is intricately connected to various metabolic pathways. Research indicates that A. hydrophila has remarkable metabolic versatility, including dissimilatory sulfate reduction and resistance mechanisms against toxic compounds . The ATP synthase complex provides the necessary energy currency (ATP) to power these diverse metabolic activities. When A. hydrophila is exposed to stress conditions, such as co-culture with predatory organisms like Tetrahymena thermophila, significant metabolic gene regulation occurs, with approximately 36% of upregulated genes being involved in metabolism . This suggests that ATP production and energy metabolism are critical components of the bacterial stress response and adaptation mechanisms.

What expression systems are most effective for producing recombinant A. hydrophila atpB?

For recombinant expression of A. hydrophila atpB, several expression systems have proven effective, with considerations similar to those used for other membrane proteins from this organism. Escherichia coli-based expression systems remain the most commonly used, particularly BL21(DE3) strains with pET vector systems that allow for controlled induction using IPTG. When working with membrane proteins like ATP synthase subunit a, specialized E. coli strains such as C41(DE3) or C43(DE3) often yield better results as they are better adapted for membrane protein expression.

Expression protocols should be optimized with the following parameters:

  • Induction temperature: 18-25°C (lower temperatures often improve proper folding)

  • IPTG concentration: 0.1-0.5 mM (lower concentrations may reduce inclusion body formation)

  • Expression time: 4-16 hours post-induction

  • Media supplementation: Addition of glucose (0.5-1%) can help regulate expression levels

For difficult-to-express membrane proteins, alternative hosts such as Pichia pastoris may be considered, particularly when post-translational modifications are important for functional studies.

How might atpB expression correlate with virulence in A. hydrophila?

A. hydrophila is recognized as an emerging pathogen with considerable virulence potential . While the ATP synthase complex is primarily associated with energy metabolism, research on bacterial pathogens suggests potential links between energy metabolism and virulence. The 4.7-Mb genome of A. hydrophila contains a large array of virulence genes that may confer upon this organism the ability to infect a wide range of hosts .

Gene expression studies have shown that when A. hydrophila is exposed to bacteriovorous predators like Tetrahymena thermophila, virulent strains exhibit the ability to evade digestion in protozoan vacuoles . This survival mechanism likely requires energy-dependent processes, suggesting a potential indirect role for ATP synthase in supporting virulence mechanisms. Further research is needed to elucidate the specific relationships between atpB expression, ATP production capacity, and the expression of virulence factors in this organism.

What structural and functional insights can be gained through comparative analysis of A. hydrophila atpB with homologs in other bacterial species?

Comparative analysis of A. hydrophila atpB with homologs in other bacterial species can provide valuable insights into evolutionary conservation, functional domains, and potential species-specific adaptations. Similar to the approach used for DNA gyrase B subunit in A. hydrophila , homology modeling can be employed to generate a 3D structural model of ATP synthase subunit a based on known crystal structures from related organisms.

Such comparative analyses might reveal:

  • Conservation of proton-conducting channels within the membrane domain

  • Species-specific adaptations in residues that interact with other ATP synthase subunits

  • Potential differences in inhibitor binding sites that could be exploited for targeted antimicrobial development

The phylogenetic analysis approach demonstrated for DNA gyrase B could be applied to atpB, potentially revealing that "homologous atpB protein may serve as a better target for the same drug which can also inhibit the growth of other bacteria" .

How does post-translational modification affect ATP synthase function in A. hydrophila?

Recent research has identified novel protein modification systems in A. hydrophila, including the NAD⁺- and Zn²⁺-independent protein lysine deacetylase AhCobQ . This finding suggests that post-translational modifications, particularly acetylation/deacetylation, may play important regulatory roles in A. hydrophila metabolism.

While direct evidence of ATP synthase subunit a modification in A. hydrophila is limited, research has shown that in other bacterial species, ATP synthase subunits can undergo various post-translational modifications, including acetylation, phosphorylation, and ADP-ribosylation, which affect enzyme activity and assembly. The discovery of multiple deacetylases in A. hydrophila with different substrate specificities suggests a complex regulatory network for protein acetylation .

Research investigating potential interactions between AhCobQ, AhCobB, or AhAcuC deacetylases and ATP synthase components would be valuable for understanding how energy metabolism is regulated in this organism under different environmental conditions.

What role might ATP synthase play in A. hydrophila stress response and environmental adaptation?

A. hydrophila thrives in diverse environments, including heavily polluted waters, and possesses resistance mechanisms against toxic compounds . The ATP synthase complex may contribute to this environmental versatility by:

  • Maintaining energy homeostasis under fluctuating nutrient conditions

  • Supporting energy-dependent efflux pumps for toxin resistance

  • Powering motility systems that allow the bacterium to seek optimal environmental niches

What purification strategies are most effective for isolating functional recombinant A. hydrophila ATP synthase subunit a?

Purifying functional membrane proteins like ATP synthase subunit a presents significant challenges due to their hydrophobic nature and tendency to aggregate when removed from the membrane environment. Based on approaches used for similar bacterial membrane proteins, the following purification strategy is recommended:

  • Membrane preparation:

    • Harvest cells and disrupt by French press or sonication

    • Remove unbroken cells and debris by low-speed centrifugation (5,000 × g, 10 min)

    • Isolate membranes by ultracentrifugation (150,000 × g, 1 hour)

  • Solubilization:

    • Resuspend membrane pellet in buffer containing:

      • 50 mM Tris-HCl, pH 8.0

      • 10% glycerol

      • 100 mM NaCl

      • Protease inhibitor cocktail

    • Add detergent (optimal choices include n-dodecyl-β-D-maltoside (DDM), 0.5-1%, or digitonin, 1-2%)

    • Incubate with gentle agitation at 4°C for 1-2 hours

  • Affinity purification:

    • For His-tagged constructs, use Ni-NTA affinity chromatography

    • Include 0.05% DDM in all purification buffers to maintain protein solubility

    • Use gradient elution with imidazole (20-250 mM)

  • Size exclusion chromatography:

    • Apply concentrated protein to a Superdex 200 column

    • Use buffer containing 20 mM Tris-HCl, pH 8.0, 100 mM NaCl, 5% glycerol, and 0.05% DDM

Alternative approaches include incorporation into nanodiscs or amphipols for improved stability during downstream functional and structural studies.

What analytical methods are available for assessing the functionality of recombinant A. hydrophila ATP synthase subunit a?

Assessing the functionality of recombinantly expressed ATP synthase subunit a requires methods that can evaluate both its correct folding and its ability to participate in proton translocation and ATP synthesis. The following analytical approaches are recommended:

  • Proton translocation assays:

    • Reconstitute purified protein or ATP synthase complex into liposomes

    • Monitor proton movement using pH-sensitive fluorescent dyes (e.g., ACMA or pyranine)

    • Assess the effect of known ATP synthase inhibitors

  • ATP synthesis/hydrolysis activity:

    • For complete ATP synthase complex reconstitution:

      • Measure ATP synthesis using luciferin/luciferase assay

      • Quantify ATP hydrolysis by monitoring inorganic phosphate release

    • Compare activity in the presence and absence of the a subunit

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure content

    • Thermal stability assays using differential scanning fluorimetry

    • Limited proteolysis to assess proper folding

  • Interaction analysis:

    • Pull-down assays to verify binding to other ATP synthase subunits

    • Blue native PAGE to assess complex formation

    • Crosslinking studies to confirm subunit-subunit interactions

What are the recommended approaches for site-directed mutagenesis studies of A. hydrophila atpB?

Site-directed mutagenesis studies of A. hydrophila atpB can provide valuable insights into structure-function relationships within the ATP synthase complex. Based on approaches used for other bacterial proteins , the following methodology is recommended:

  • Target selection:

    • Identify conserved residues through multiple sequence alignment with homologs

    • Focus on residues in predicted proton channels or subunit interfaces

    • Consider residues implicated in inhibitor binding

  • Mutagenesis protocol:

    • Use QuikChange site-directed mutagenesis or inverse PCR approaches

    • Design primers with 15-20 nucleotides flanking each side of the mutation

    • For challenging templates with high GC content, consider adding DMSO (3-5%) to the PCR reaction

  • Validation strategy:

    • Confirm mutations by DNA sequencing

    • Assess expression levels of mutant proteins by Western blotting

    • Compare wild-type and mutant protein stability using thermal shift assays

  • Functional characterization:

    • Evaluate effects on ATP synthesis/hydrolysis activities

    • Assess proton translocation efficiency

    • Determine impacts on subunit assembly using BN-PAGE

Table 1. Example mutation targets in ATP synthase subunit a based on homology with E. coli

Residue PositionPredicted FunctionRecommended SubstitutionsExpected Phenotype
Arg210*Proton translocationR210K, R210Q, R210ADisrupted proton movement
Glu219*Proton channelE219Q, E219D, E219AAltered proton affinity
Ser199*Subunit c interfaceS199A, S199T, S199CImpaired rotor-stator interaction
His245*Inhibitor bindingH245A, H245F, H245YModified inhibitor sensitivity

*Note: Residue positions are approximate based on E. coli homology and would need to be verified for A. hydrophila

How can structural biology techniques be applied to study A. hydrophila ATP synthase?

Structural biology techniques provide powerful approaches for understanding the molecular architecture and mechanism of ATP synthase. For A. hydrophila ATP synthase, the following methods are particularly relevant:

  • Cryo-electron microscopy (Cryo-EM):

    • Most suitable for intact ATP synthase complex

    • Sample preparation:

      • Purify ATP synthase complex in amphipols or nanodiscs

      • Apply 3-4 μl to glow-discharged grids

      • Vitrify using rapid freezing in liquid ethane

    • Data collection:

      • Use 300 kV electron microscope with direct electron detector

      • Collect images with dose fractionation (40-50 e-/Ų)

    • Data processing:

      • Motion correction and CTF estimation

      • Particle picking and 2D classification

      • 3D classification and refinement

  • X-ray crystallography:

    • More challenging for the complete complex but suitable for individual subunits

    • For ATP synthase subunit a:

      • Obtain highly pure, homogeneous protein

      • Screen crystallization conditions (often requiring lipidic cubic phase for membrane proteins)

      • Collect diffraction data at synchrotron facilities

  • Nuclear Magnetic Resonance (NMR):

    • Limited to smaller domains or fragments of subunit a

    • Requires isotopic labeling (¹⁵N, ¹³C)

    • Particularly useful for studying protein dynamics and ligand binding

  • Molecular modeling:

    • Homology modeling based on known structures (similar to approach used for DNA gyrase B )

    • Molecular dynamics simulations to study conformational dynamics

    • Docking studies to identify potential inhibitor binding sites

How can recombinant A. hydrophila ATP synthase subunit a be utilized in drug discovery?

Recombinant A. hydrophila ATP synthase subunit a can serve as a valuable target for antimicrobial drug discovery, particularly given the emerging pathogenic potential of this organism . The approach would parallel methods used for DNA gyrase B subunit of A. hydrophila , where homology modeling and structure-based drug screening identified potential inhibitors.

For ATP synthase-targeted drug discovery:

  • Target validation:

    • Generate atpB knockout or conditional mutants to confirm essentiality

    • Evaluate effects of known ATP synthase inhibitors on bacterial growth

    • Identify potential species-specific features that could be exploited for selective targeting

  • Screening approaches:

    • Structure-based virtual screening using the 3D model of ATP synthase subunit a

    • High-throughput biochemical assays using reconstituted ATP synthase

    • Fragment-based drug discovery focusing on the membrane-embedded regions

  • Candidate optimization:

    • Structure-activity relationship studies to improve potency and selectivity

    • Assessment of off-target effects on human ATP synthase

    • Evaluation of compound stability, solubility, and membrane permeability

  • Resistance studies:

    • Characterize potential resistance mechanisms through in vitro selection

    • Identify mutations that confer resistance and map them on the structural model

    • Design inhibitor combinations or multi-targeting approaches to minimize resistance development

What is the potential significance of A. hydrophila ATP synthase research in understanding bacterial adaptation to environmental stressors?

Research on A. hydrophila ATP synthase has significant implications for understanding how this versatile bacterium adapts to various environmental challenges. As noted in the genome analysis, A. hydrophila possesses remarkable metabolic capabilities and resistance mechanisms against toxic compounds encountered in polluted waters .

The ATP synthase complex, as the primary producer of cellular ATP, likely plays a central role in:

  • Environmental persistence:

    • Maintaining energy production under nutrient limitation

    • Supporting metabolic flexibility for utilizing diverse carbon sources

    • Enabling adaptation to fluctuating oxygen levels in aquatic environments

  • Stress response mechanisms:

    • Powering energy-dependent stress responses, similar to the metabolic shifts observed during interaction with predatory organisms

    • Supporting membrane potential homeostasis under pH or osmotic stress

    • Fueling repair mechanisms following exposure to environmental toxicants

  • Host-pathogen interactions:

    • Providing energy for virulence factor expression

    • Supporting survival within host immune cells

    • Enabling adaptation to host microenvironments with varying nutrient availability

The significance of this research extends beyond A. hydrophila to inform broader understanding of bacterial bioenergetics and adaptation, with potential applications in environmental monitoring, bioremediation, and infection control strategies.

What are promising areas for future research on A. hydrophila ATP synthase?

Based on current knowledge gaps and emerging technologies, several promising directions for future research on A. hydrophila ATP synthase include:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.