Recombinant Aeromonas hydrophila subsp. hydrophila ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Aeromonas hydrophila subsp. hydrophila ATP Synthase Subunit b (atpF)

Recombinant Aeromonas hydrophila subsp. hydrophila ATP synthase subunit b (atpF) refers to a specific ATP synthase subunit b, derived from the bacterium Aeromonas hydrophila subsp. hydrophila, that has been produced using recombinant DNA technology . ATP synthase is a vital enzyme complex that synthesizes adenosine triphosphate (ATP), the primary energy currency in cells, and subunit b is one of its components .

ATP Synthase and Subunit b Function

ATP synthase, also known as F1F0-ATPase, is essential for energy production in bacteria, mitochondria, and chloroplasts . It harnesses the electrochemical gradient of protons across the membrane to drive the synthesis of ATP from adenosine diphosphate (ADP) and inorganic phosphate . The enzyme consists of two main parts: the F0 portion, which is embedded in the membrane and facilitates proton transport, and the F1 portion, which is responsible for ATP synthesis . Subunit b is a component of the F0 portion and plays a crucial role in connecting the rotating c-ring to the static a-subunit, thus stabilizing the entire complex .

Aeromonas hydrophila as a Pathogen

Aeromonas hydrophila is a Gram-negative bacterium recognized as an opportunistic pathogen that can cause Motile Aeromonas Septicemia (MAS) in fish and other vertebrates . It poses significant challenges in aquaculture, leading to substantial economic losses . The pathogenesis of A. hydrophila involves multiple factors, and understanding the bacterium's mechanisms of infection is crucial for developing effective control strategies, such as vaccines and targeted drug therapies .

Recombinant Production and Research Applications

Producing the ATP synthase subunit b through recombinant technology allows researchers to study its properties and functions in isolation . Recombinant proteins are produced by cloning the gene encoding the protein of interest into an expression vector, which is then introduced into a host organism like E. coli for protein production . The recombinant protein can then be purified and used for various applications, including:

  • Structural studies: Determining the three-dimensional structure of the protein .

  • Functional assays: Investigating the protein's role in ATP synthesis and other cellular processes .

  • Vaccine development: Exploring the potential of the protein as a vaccine candidate against A. hydrophila infections .

  • Drug discovery: Screening for compounds that can inhibit the protein's activity, potentially leading to new antibacterial drugs .

Potential for Vaccine Development

Outer membrane proteins and ATPases of A. hydrophila have been identified as potential vaccine candidates . Recombinant proteins can stimulate protective immunity in hosts, making them valuable in combating A. hydrophila infections . For example, research has demonstrated that recombinant ATPase proteins can induce a significant immune response and protect catfish against virulent A. hydrophila strains .

Tables of Data and Research Findings

ProteinFunctionReference
OmpCOuter membrane protein; B-cell epitopes can confer protection against bacterial virulence.
DNA gyrase B subunitTarget for drug discovery; inhibition of gyrase activity can control A. hydrophila infection.
ATPasePotential subunit vaccine; immunization with recombinant ATPase protein protects against virulent A. hydrophila infection.
MsrA and MsrBRequired for resistance to predatory protozoans and survival within macrophages; MsrA deletion reduces virulence in zebrafish.
AntibioticSensitivity of A. hydrophila IsolatesReference
CephalothinResistant
AmpicillinResistant
NovobiocinResistant
NitrofurazoneResistant
GentamicinSensitive (80%)
Co-trimaxazoleSensitive (92%)
ChloramphenicolSensitive
CiprofloxacinSensitive

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; AHA_4266; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240)
Target Names
atpF
Target Protein Sequence
MNINATLLGQAIAFFIFVVFCMKYVWPPLMAAIEARQKAIADGLSSAERAKKDLDLAKAN ATDQLKEAKLQAAEIIEQANKRKAQIIDEAAAGAHSEREKILAQGRAEIEAERHRAKEEL RKQVAALAIAGAEKILARQIDQAANSDIVDKLVAEL
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP utilizing a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembranous) and the F(0) membrane proton channel, connected by a central and a peripheral stalk. ATP synthesis within the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the basic structure and function of ATP synthase subunit b in A. hydrophila?

ATP synthase subunit b (atpF) in A. hydrophila is a critical component of the F₀F₁-ATP synthase complex. This protein serves as part of the peripheral stalk, connecting the F₁ catalytic domain to the membrane-embedded F₀ domain. In A. hydrophila, atpF plays a crucial role in maintaining structural integrity of the ATP synthase complex during the rotational catalysis mechanism that generates ATP .

The protein consists of a transmembrane α-helical domain at the N-terminus that anchors it to the membrane, and an extended α-helical domain that interacts with other stator subunits. Similar to other bacterial ATP synthases, the b subunit in A. hydrophila likely functions as a dimer in the complete enzyme complex .

How does A. hydrophila ATP synthase subunit b compare to homologous proteins in other bacterial species?

Sequence analysis indicates that A. hydrophila ATP synthase subunit b shares significant homology with equivalent proteins in other gram-negative bacteria, particularly those within the γ-proteobacteria class. While maintaining core functional domains, the A. hydrophila atpF demonstrates species-specific variations in certain regions that may reflect adaptation to the organism's aquatic environment and metabolic requirements .

Comparative analysis shows:

OrganismSequence identity to A. hydrophila atpFNotable structural differences
E. coli~60-65%More conserved C-terminal domain
Vibrio spp.~70-75%Similar adaptation for aquatic lifestyle
P. aeruginosa~55-60%Variations in membrane-spanning regions

These differences may contribute to the specific pH and temperature adaptations observed in A. hydrophila ATP synthase functionality, enabling the bacterium to thrive in diverse aquatic environments .

What are the optimal expression systems for recombinant A. hydrophila atpF production?

Successful expression of recombinant A. hydrophila atpF has been achieved in several systems, with E. coli being the most widely used. The recommended approach involves:

E. coli expression system optimization:

  • Strain selection: BL21(DE3) or T7 Express lysY/Iq strains have shown superior expression .

  • Vector systems: pET vector systems with N-terminal His-tags show optimal expression levels for atpF .

  • Induction parameters: IPTG concentration of 0.5-1.0 mM at OD₆₀₀ of 0.6-0.8, with post-induction growth at 30°C for 4-6 hours to minimize inclusion body formation .

Other expression systems have shown varied success:

  • Yeast and baculovirus systems may provide better protein folding but at lower yields

  • Mammalian cell expression systems offer potential for specific post-translational modifications but are less commonly used due to complexity and cost

It's worth noting that co-expression with molecular chaperones (DnaK, DnaJ, and GrpE) can significantly increase soluble protein yields, particularly for membrane-associated domains of atpF .

What purification strategies are most effective for obtaining high-purity recombinant atpF protein?

Purification of recombinant A. hydrophila atpF typically employs a multi-step approach:

  • Initial capture using affinity chromatography:

    • Immobilized metal affinity chromatography (IMAC) with Ni-NTA resin for His-tagged constructs

    • Optimal binding in 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10 mM imidazole

    • Elution with 250-300 mM imidazole gradient

  • Intermediate purification:

    • Ion exchange chromatography (typically anion exchange) using Q-Sepharose

    • Buffer systems maintaining pH 7.0-8.0 with 50-150 mM NaCl gradients

  • Polishing step:

    • Size exclusion chromatography using Superdex 75 or 200 columns

    • Running buffer typically containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, and 5% glycerol

Purification challenges often involve membrane-associated regions of atpF. Addition of mild detergents (0.05-0.1% n-dodecyl-β-D-maltoside) during extraction and initial purification steps significantly improves solubility and yield of the full-length protein .

Final product quality should be assessed by SDS-PAGE (>90% purity) and verified by Western blotting using anti-His antibodies or antibodies specific to atpF .

What techniques are most informative for structural analysis of recombinant atpF?

Structural characterization of recombinant A. hydrophila atpF benefits from a combination of approaches:

Biophysical techniques:

  • Circular dichroism (CD) spectroscopy: Valuable for analyzing secondary structure content, particularly the α-helical components typical of atpF proteins. Measurements at 222 nm in far-UV region provide quantitative assessment of helical content .

  • Limited proteolysis coupled with mass spectrometry: Helps identify domain boundaries and structurally stable regions.

  • Dynamic light scattering (DLS): Useful for assessing oligomeric state and homogeneity of the purified protein.

Higher-resolution structural approaches:

  • X-ray crystallography: Challenging due to the flexibility of the extended helical regions but feasible for stable domains or engineered constructs.

  • Cryo-electron microscopy: Particularly valuable for visualizing atpF in the context of the complete ATP synthase complex.

  • NMR spectroscopy: Suitable for studying dynamics of specific domains, particularly when using selectively labeled protein samples .

Computational approaches:

  • Homology modeling based on related structures from other bacterial species can provide initial structural insights, especially when combined with molecular dynamics simulations to assess stability .

How can researchers assess the functional activity of purified recombinant atpF?

Functional characterization of atpF requires assessment of both its structural role in the ATP synthase complex and potential ATP binding/hydrolysis activities:

Binding interaction assays:

  • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to quantify binding to other ATP synthase subunits

  • Pull-down assays with other recombinant ATP synthase components to verify complex formation capabilities

ATPase activity assessments:

  • Malachite green phosphate assay for sensitive detection of phosphate release from ATP hydrolysis

  • Coupled enzyme assays measuring NADH oxidation as an indicator of ATP hydrolysis

Reconstitution experiments:

  • Incorporation into liposomes with other ATP synthase components to assess functional complex formation

  • Proton translocation assays using pH-sensitive fluorescent dyes when reconstituted into proteoliposomes

Typical ATPase activity parameters for reconstituted systems containing properly folded atpF show:

ParameterTypical valueNotes
Km for ATP0.2-0.5 mMMg2+ required as cofactor
Vmax0.5-1.0 μmol min⁻¹ mg⁻¹At optimal pH (7.0-8.0) and temperature (30-37°C)
Optimal pH7.0-8.0Activity decreases significantly below pH 6.5
Temperature optimum30-37°CReflects natural habitat of A. hydrophila

What gene editing approaches can be used to study atpF function in A. hydrophila?

Advanced genetic manipulation techniques have enabled precise functional studies of atpF in A. hydrophila:

CRISPR-Cas9 methodology:

  • Design of specific guide RNAs targeting the atpF gene sequence

  • Homology-directed repair (HDR) templates for introducing precise mutations or tags

  • Optimization of transformation protocols for A. hydrophila to achieve efficient editing

Site-directed mutagenesis approaches:

  • Creation of specific amino acid substitutions to study structure-function relationships

  • Introduction of mutations in predicted functional domains:

    • ATP-binding motifs

    • Interaction interfaces with other ATP synthase subunits

    • Membrane-spanning regions

Complementation strategies:

  • Generation of conditional knockout strains with tightly regulated expression systems

  • Trans-complementation with wild-type or mutant atpF variants to assess functional restoration

Research has shown that mutations in ATP synthase components can significantly impact bacterial virulence and survival. For example, studies with methionine sulfoxide reductase genes in A. hydrophila demonstrated that gene knockouts dramatically reduced resistance to predation by Tetrahymena thermophila and attenuated virulence in zebrafish models .

What are the common challenges in expressing and purifying full-length atpF, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant atpF:

Expression challenges:

  • Toxicity to host cells: Use tightly controlled expression systems with low basal expression and co-expression with chaperones (DnaK, DnaJ, GrpE) as demonstrated effective in similar membrane protein studies

  • Inclusion body formation: Lower induction temperature (16-25°C), reduce IPTG concentration (0.1-0.5 mM), and extend expression time (overnight)

  • Protein degradation: Add protease inhibitors directly after cell lysis, use protease-deficient host strains

Purification challenges:

  • Poor solubility: Use mild detergents (0.05-0.1% n-dodecyl-β-D-maltoside or 0.5-1% CHAPS) during extraction and purification

  • Co-purifying contaminants: Implement stringent washing steps during IMAC (20-40 mM imidazole) and additional purification steps (ion exchange, size exclusion)

  • Protein aggregation: Include stabilizing agents (5-10% glycerol, 100-150 mM NaCl) in all buffers

Storage stability issues:

  • Freeze-thaw degradation: Aliquot purified protein and avoid repeated freeze-thaw cycles

  • Loss of activity during storage: Store at -80°C in buffer containing 50% glycerol, or lyophilize in the presence of stabilizers (6% trehalose)

How can researchers address specific technical challenges in functional studies of recombinant atpF?

Several methodological challenges arise in functional characterization of atpF:

Reconstitution difficulties:

  • Optimize lipid composition for proteoliposome formation (typical successful mixture: 70% phosphatidylcholine, 20% phosphatidylethanolamine, 10% cardiolipin)

  • Use stepwise dialysis for detergent removal during reconstitution to improve incorporation efficiency

  • Verify protein orientation in liposomes using protease protection assays

Activity measurement interference:

  • Control for potential contaminant ATPase activity by using specific inhibitors for different ATPase types

  • Include appropriate negative controls (heat-inactivated protein, buffer only) in all activity assays

  • Use ATP analogs and competition assays to confirm specificity of ATP binding

Structural characterization limitations:

  • For challenging regions, consider using synthetic peptides corresponding to specific domains

  • Employ cross-linking studies to capture transient interactions with partner proteins

  • Use homology modeling guided by limited experimental data (CD spectroscopy, limited proteolysis) for structural predictions

Troubleshooting inconsistent results:

  • Implement rigorous quality control of purified protein (analytical SEC, dynamic light scattering)

  • Standardize buffer conditions and experimental parameters across experiments

  • Consider batch-to-batch variation in protein preparations when interpreting functional data

What emerging technologies show promise for advancing atpF research?

Several cutting-edge approaches have potential to significantly advance our understanding of atpF structure, function, and applications:

Advanced structural biology techniques:

  • Cryo-electron tomography: For visualizing ATP synthase complexes in their native membrane environment

  • Integrative structural biology: Combining data from multiple experimental techniques (SAXS, NMR, XL-MS) with computational modeling

  • Single-molecule techniques: FRET and optical tweezers for studying conformational dynamics

Systems biology approaches:

  • Metabolomics integration: Linking atpF function to broader cellular energy metabolism

  • Interactome mapping: Comprehensive identification of all atpF protein interactions within the cell

  • Multi-omics integration: Combining proteomics, transcriptomics, and metabolomics data to understand system-level functions

Advanced functional assessments:

  • In vivo ATP synthesis measurements: Development of genetically encoded fluorescent ATP sensors

  • High-throughput mutagenesis: Deep mutational scanning to comprehensively map structure-function relationships

  • Time-resolved studies: Capture transient states during ATP synthesis/hydrolysis cycles

What are the significant knowledge gaps in our understanding of A. hydrophila atpF that warrant further investigation?

Despite progress in ATP synthase research, several critical knowledge gaps remain specific to A. hydrophila atpF:

Structural dynamics:

  • Detailed understanding of conformational changes during the catalytic cycle

  • Species-specific features of atpF compared to well-studied model organisms

  • Role of potential post-translational modifications in regulating function

Physiological regulation:

  • Response of ATP synthase to environmental stressors relevant to A. hydrophila's ecological niche

  • Transcriptional and post-translational regulation mechanisms of atpF expression

  • Potential moonlighting functions beyond ATP synthesis

Pathogenesis connection:

  • Precise role of ATP synthase in A. hydrophila virulence and host adaptation

  • Potential as a therapeutic target for treating A. hydrophila infections

  • Correlation between ATP synthase activity and antibiotic resistance mechanisms

Evolutionary considerations:

  • Selective pressures driving atpF sequence conservation and divergence

  • Horizontal gene transfer events in the evolution of A. hydrophila ATP synthase

  • Adaptation of ATP synthase for function in diverse environmental conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.