Recombinant Aeromonas hydrophila subsp. hydrophila Na (+)-translocating NADH-quinone reductase subunit E

Shipped with Ice Packs
In Stock

Description

Overview of Na⁺-Translocating NADH-Quinone Reductase Subunit E

NqrE is a subunit of the Na⁺-NQR complex, a six-subunit membrane protein (NqrA–F) that serves as a primary sodium pump in Aeromonas hydrophila. The recombinant form is produced via heterologous expression systems (e.g., E. coli) for research and vaccine development .

Recombinant Production and Purification

Recombinant NqrE is engineered with affinity tags (e.g., His-tag) for purification and stability :

  • Expression Vector: Typically cloned into plasmids optimized for high-yield expression in E. coli .

  • Purification: Immobilized metal affinity chromatography (IMAC) followed by buffer exchange into Tris-based storage buffers .

  • Storage: Stable at -20°C or -80°C in 50% glycerol; avoid repeated freeze-thaw cycles .

Functional Role in the Na⁺-NQR Complex

The Na⁺-NQR complex catalyzes two redox reactions:

  1. NADH Oxidation: Mediated by subunit NqrF (contains FAD and a 2Fe-2S cluster) .

  2. Ubiquinone Reduction: Involves subunits NqrA–E, with NqrE participating in Na⁺ translocation .

Key Interactions:

  • NqrD and NqrE: Form a subcomplex that ligates Fe centers critical for electron transport .

  • NqrB and NqrC: Bind covalently attached FMN cofactors .

Energy Conservation:

  • The Na⁺ motive force generated drives ATP synthesis, substrate uptake, and flagellar rotation .

Research Applications

Recombinant NqrE is utilized in:

  1. Enzyme Mechanism Studies: Investigating Na⁺-NQR’s role in oxidative stress and Fe²⁺ uptake .

  2. Vaccine Development: As an antigenic component for Aeromonas-targeted vaccines .

  3. Structural Biology: Crystallography and mutagenesis to map Fe-S cluster binding sites .

Comparative Proteomics and Pathogenicity

  • Iron Homeostasis: A. hydrophila Δnqr mutants upregulate FeoB, enhancing Fe²⁺ uptake under Na⁺-NQR deficiency .

  • Virulence Link: Na⁺-NQR-derived superoxide (via FAD in NqrF) modulates oxidative stress responses, influencing pathogenicity .

Future Directions

  • Targeted Drug Design: Exploiting NqrE’s role in Na⁺ translocation for antimicrobial development.

  • Structural Resolution: High-resolution cryo-EM studies to elucidate Na⁺ transport mechanisms .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution. Store at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein. Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nqrE; AHA_1140; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240)
Target Names
nqrE
Target Protein Sequence
MEHYISLLIRSIFIENLALSFFLGMCTFLAVSKKVKTAMGLGIAVIVVQTVAVPANNLIY NYVLKDGALVSGLDLSFLSFITFIGVIAALVQILEMALDKYFPALYNALGIFLPLITVNC AIFGGVSFMVQRDYNFVESVVYGVGSGAGWMLAIVAMAGIREKMKYSDVPEGLRGLGITF ITAGLMALGFMSFSGISL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two consecutive reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Na(+)-translocating NADH-quinone reductase subunit E and what is its role in Aeromonas hydrophila?

Na(+)-translocating NADH-quinone reductase subunit E (NqrE) is a transmembrane protein component of the Na+-NQR complex in Aeromonas hydrophila subsp. hydrophila. This protein functions within a respiratory chain enzyme complex that couples the oxidation of NADH to quinone with sodium ion translocation across the cellular membrane. The protein is encoded by the nqrE gene (locus name AHA_1140) and is 198 amino acids in length. As part of the Na+-NQR complex, NqrE contributes to cellular energy production and maintenance of ion gradients necessary for bacterial survival .

What are the optimal storage conditions for recombinant NqrE protein?

For optimal stability of recombinant Na(+)-translocating NADH-quinone reductase subunit E, store the protein at -20°C in a Tris-based buffer containing 50% glycerol. For extended storage periods, maintaining the protein at -80°C is recommended. To preserve protein integrity, avoid repeated freeze-thaw cycles which can lead to protein denaturation and loss of activity. Instead, prepare small working aliquots that can be stored at 4°C for up to one week of active experimentation. Always verify protein stability and activity before critical experiments, particularly if the protein has been stored for extended periods .

What detection methods can be developed for studying Aeromonas hydrophila proteins?

Based on recent methodological advances for detecting Aeromonas hydrophila, several approaches can be adapted for studying NqrE or other A. hydrophila proteins:

  • CRISPR/Cas12a-based detection systems: Researchers have successfully developed dual recombinase-assisted amplification (dRAA) methods coupled with CRISPR/Cas12a for detecting A. hydrophila genes. This approach could be modified to detect and quantify nqrE expression with high sensitivity (as low as 2 copies of genomic DNA) .

  • Recombinant protein expression systems: For functional studies, expressing NqrE in heterologous systems can be effective. Similar to the approaches used with other A. hydrophila proteins (such as Aha1), the nqrE gene can be cloned into appropriate expression vectors and expressed in systems like E. coli or Lactobacillus casei for further characterization .

  • Immunological detection methods: Western blotting, flow cytometry, and immunofluorescence techniques have been successfully applied to recombinant A. hydrophila proteins and could be adapted for NqrE studies, particularly when investigating protein localization and expression levels .

What purification strategies are most effective for membrane-bound proteins like NqrE?

Purification of membrane-bound proteins such as Na(+)-translocating NADH-quinone reductase subunit E requires specialized approaches:

  • Detergent solubilization protocol:

    • Harvest bacterial cells expressing recombinant NqrE

    • Resuspend in buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl

    • Disrupt cells using sonication or French press

    • Collect membrane fraction by ultracentrifugation (100,000×g for 1 hour)

    • Solubilize membrane proteins using mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 1% w/v or CHAPS at 0.5-1% w/v

    • Incubate with gentle rotation at 4°C for 2-3 hours

    • Remove insoluble material by ultracentrifugation

    • Proceed with affinity chromatography based on the protein tag

  • Two-phase purification approach:

    • Initial capture using immobilized metal affinity chromatography (IMAC) if a His-tag is present

    • Secondary purification using ion-exchange chromatography

    • Final polishing step with size-exclusion chromatography to separate protein complexes

  • Activity preservation considerations:

    • Maintain detergent concentration above critical micelle concentration throughout purification

    • Include glycerol (10-20%) to stabilize the protein structure

    • Consider including lipids or lipid-like molecules to maintain protein conformation

The optimal purification strategy should be determined empirically, as membrane protein behavior varies significantly based on their specific properties.

How can functional assays be designed to assess NqrE activity within the Na+-NQR complex?

To evaluate the functional activity of Na(+)-translocating NADH-quinone reductase subunit E within the complete Na+-NQR complex, the following assays can be implemented:

  • NADH oxidation assay:

    • Prepare membrane vesicles containing the Na+-NQR complex

    • Measure NADH oxidation spectrophotometrically at 340 nm

    • Compare activity in the presence and absence of Na+ ions

    • Calculate enzyme kinetics parameters (Km and Vmax) for NADH

  • Quinone reduction assay:

    • Monitor the reduction of ubiquinone analogs (such as Q1 or decylubiquinone)

    • Measure absorbance changes at appropriate wavelengths (275-290 nm)

    • Determine electron transfer rates and efficiency

  • Sodium ion translocation measurements:

    • Prepare proteoliposomes containing purified Na+-NQR complex

    • Use sodium-sensitive fluorescent dyes (e.g., SBFI) to monitor Na+ movement

    • Alternatively, employ 22Na+ radioisotope to quantify transport activity

    • Compare wild-type activity to systems with modified or absent NqrE

  • Site-directed mutagenesis studies:

    • Identify conserved residues in NqrE through sequence alignment

    • Generate point mutations in these residues

    • Assess the impact on Na+ translocation and NADH oxidation

    • Map functional domains involved in ion translocation

What role might the NqrE subunit play in Aeromonas hydrophila pathogenicity?

While direct evidence linking NqrE to pathogenicity mechanisms is limited in the available research, several hypotheses can be proposed based on known functions of respiratory chain components in bacterial pathogens:

  • Energy metabolism during infection:

    • The Na+-NQR complex likely provides essential energy for bacterial survival during host colonization

    • NqrE, as a critical component of this complex, may indirectly support virulence by enabling metabolic flexibility in different host environments

  • Adaptation to environmental conditions:

    • Na+-dependent respiration could provide advantages in high-salt or alkaline environments

    • This adaptation may contribute to A. hydrophila's ability to persist in diverse habitats, including aquatic environments and host tissues

  • Potential interconnection with virulence pathways:

    • Energetic status affects expression of virulence factors in many bacterial pathogens

    • Na+-NQR activity might influence regulatory networks controlling virulence gene expression

    • Membrane potential generated by Na+ translocation could affect secretion systems involved in toxin delivery

  • Research approach for investigation:

    • Generate nqrE knockout mutants and assess virulence in appropriate models

    • Compare transcriptome profiles between wild-type and nqrE mutants during infection

    • Evaluate the expression of established virulence factors such as aerolysin (encoded by aerA) and hemolysin (encoded by hlyA) in relation to NqrE activity

Further experimental investigation is needed to establish clear connections between NqrE function and virulence mechanisms in A. hydrophila.

How does the structure-function relationship of NqrE compare with similar proteins in other bacterial species?

The structure-function relationship analysis of Na(+)-translocating NADH-quinone reductase subunit E reveals important evolutionary and functional patterns across bacterial species:

SpeciesProtein HomologyTransmembrane DomainsFunctional ConservationPhylogenetic Relationship
A. hydrophilaReference (100%)5-6 predictedComplete Na+-NQR functionγ-Proteobacteria
Vibrio cholerae65-70%5-6 similar arrangementFunctionally analogousClose γ-Proteobacteria relative
Pseudomonas aeruginosa45-50%4-5 with modified topologyPartial functional overlapMore distant γ-Proteobacteria
Escherichia coli30-35%Significant differencesUses H+ rather than Na+Different respiratory strategy
Bacillus subtilis<20%Different arrangementConvergent evolutionGram-positive, distant relative

Key structural features conserved across species include:

  • Hydrophobic transmembrane helices capable of spanning the lipid bilayer

  • Conserved residues involved in quinone binding

  • Charged residues potentially forming the ion translocation pathway

Functional studies across these species suggest that while the core mechanism of electron transfer is preserved, the coupling to ion translocation has evolved differently. This comparative analysis provides insights into evolutionary adaptation of respiratory chain components across diverse bacterial lineages and environmental niches.

What are the common challenges in expressing and purifying functional NqrE protein?

Researchers frequently encounter several challenges when working with Na(+)-translocating NADH-quinone reductase subunit E due to its hydrophobic nature and membrane localization:

  • Expression barriers and solutions:

    • Problem: Low expression yields in conventional systems

    • Solution: Use specialized expression strains designed for membrane proteins (C41(DE3), C43(DE3))

    • Problem: Protein toxicity to expression host

    • Solution: Implement tightly controlled inducible expression systems; maintain low induction temperatures (16-20°C)

  • Solubilization difficulties:

    • Problem: Inefficient extraction from membranes

    • Solution: Screen multiple detergents (DDM, LDAO, CHAPS) at various concentrations

    • Problem: Protein aggregation during solubilization

    • Solution: Include stabilizing agents (glycerol, specific lipids) in buffers

  • Purification complications:

    • Problem: Co-purification with other membrane components

    • Solution: Implement multiple orthogonal purification steps; consider on-column detergent exchange

    • Problem: Loss of associated cofactors during purification

    • Solution: Supplement buffers with essential cofactors; minimize exposure to harsh conditions

  • Activity preservation:

    • Problem: Loss of functional activity during purification

    • Solution: Reconstitute purified protein into liposomes or nanodiscs to restore native-like membrane environment

    • Problem: Difficulty in activity assessment

    • Solution: Develop coupled assays that monitor indirect indicators of activity when direct measurements are challenging

Systematic optimization of each step, potentially using design of experiments (DoE) approaches, is recommended to overcome these challenges effectively.

How can researchers troubleshoot inconsistent results in NqrE functional assays?

When facing inconsistent results in functional assays of Na(+)-translocating NADH-quinone reductase subunit E, consider the following systematic troubleshooting approach:

  • Protein quality assessment:

    • Verify protein integrity by SDS-PAGE and Western blotting

    • Confirm proper folding using circular dichroism spectroscopy

    • Assess aggregation state through size-exclusion chromatography

    • Check for post-translational modifications that might affect function

  • Experimental conditions optimization:

    • Buffer composition: Systematically vary pH, ionic strength, and buffer components

    • Temperature sensitivity: Test activity across a range of temperatures (4-37°C)

    • Detergent effects: Compare activity in different detergent micelles or after reconstitution

    • Ion dependencies: Verify Na+ concentration requirements and potential inhibitory effects of other ions

  • Assay-specific considerations:

    • Enzyme kinetics: Ensure substrate concentrations span appropriate ranges (0.2-5× Km)

    • Time-course measurements: Verify linearity of reaction rates during measurement periods

    • Equipment calibration: Regularly calibrate spectrophotometers and other measurement devices

    • Control reactions: Include positive and negative controls in each experimental series

  • Statistical approach to variability:

    • Perform at least three independent biological replicates

    • Calculate coefficients of variation to quantify reproducibility

    • Apply appropriate statistical tests to determine significance of results

    • Consider using statistical design of experiments to identify key variables affecting outcomes

By systematically addressing these factors, researchers can identify sources of variability and develop standardized protocols that yield consistent, reliable results.

How can emerging CRISPR technologies be applied to study NqrE function in Aeromonas hydrophila?

CRISPR technologies offer powerful approaches for investigating Na(+)-translocating NADH-quinone reductase subunit E function in Aeromonas hydrophila:

  • Genome editing applications:

    • Generate precise nqrE knockouts to assess phenotypic consequences

    • Create point mutations to study structure-function relationships

    • Develop conditional knockdowns using CRISPRi systems for essential genes

    • Engineer tagged versions of NqrE for localization and interaction studies

  • Adaptation of CRISPR/Cas12a detection systems:

    • Develop highly sensitive detection methods for nqrE expression based on the dRAA-CRISPR/Cas12a approach

    • Design crRNAs specifically targeting nqrE sequences for detection and quantification

    • Implement multiplexed detection systems to simultaneously monitor nqrE and other respiratory complex genes

    • Achieve sensitivity levels as low as 2 copies of target DNA per reaction

  • CRISPRa for expression modulation:

    • Upregulate nqrE expression to assess effects on respiratory efficiency

    • Simultaneously modulate multiple Na+-NQR complex components

    • Create expression gradients to determine threshold levels required for function

  • Base editing for structure-function studies:

    • Introduce specific amino acid changes without double-strand breaks

    • Systematically modify conserved residues to map functional domains

    • Engineer variants with altered ion selectivity or coupling efficiency

These CRISPR-based approaches provide unprecedented precision for manipulating and studying NqrE function in its native context, bypassing many limitations of traditional genetic methods.

What potential role could NqrE play in developing new antimicrobial strategies against Aeromonas hydrophila?

Na(+)-translocating NADH-quinone reductase subunit E represents a promising target for novel antimicrobial strategies against Aeromonas hydrophila:

  • Target validation rationale:

    • NqrE is essential for Na+-NQR complex function and bacterial energy metabolism

    • The protein has no direct human homolog, potentially reducing toxicity concerns

    • Targeting respiratory chain components can disrupt bacterial energy production

    • A. hydrophila strains resistant to conventional antibiotics might remain susceptible to NqrE inhibitors

  • Potential therapeutic approaches:

    • Small molecule inhibitors: Develop compounds that selectively bind to NqrE and disrupt its function

    • Peptide-based inhibitors: Design peptides that interfere with NqrE assembly into the Na+-NQR complex

    • Antibody-based strategies: Generate specific antibodies against surface-exposed domains of NqrE

    • Antisense technologies: Develop antisense oligonucleotides targeting nqrE mRNA

  • Combination therapy prospects:

    • NqrE inhibitors could sensitize bacteria to existing antibiotics

    • Dual targeting of different respiratory chain components may prevent resistance development

    • Combining with inhibitors of virulence factors like aerolysin or hemolysin might enhance therapeutic efficacy

  • Recombinant vaccine potential:

    • Explore NqrE as a vaccine antigen, similar to approaches with other A. hydrophila proteins

    • Consider delivery systems like those used with Aha1 protein, which showed promising results in common carp models

    • Evaluate both recombinant protein immunization and DNA vaccine approaches

This research direction represents a frontier in combating A. hydrophila infections, particularly valuable for aquaculture applications and addressing infections resistant to conventional antibiotics.

How do environmental factors influence NqrE expression and function in Aeromonas hydrophila?

Environmental factors significantly impact the expression and function of Na(+)-translocating NADH-quinone reductase subunit E in Aeromonas hydrophila, with important implications for bacterial physiology and pathogenicity:

Understanding these environmental influences provides insights into A. hydrophila's adaptive strategies and could inform approaches for controlling its growth in various settings.

How can systems biology approaches be used to understand NqrE's role in Aeromonas hydrophila metabolism?

Systems biology offers powerful frameworks to contextualize Na(+)-translocating NADH-quinone reductase subunit E within the broader metabolic network of Aeromonas hydrophila:

  • Multi-omics integration strategies:

    • Combine transcriptomics, proteomics, and metabolomics data from wild-type and nqrE mutant strains

    • Develop correlation networks between NqrE expression/activity and global metabolic patterns

    • Identify compensatory mechanisms activated when NqrE function is compromised

    • Map changes in metabolic flux distribution when Na+-NQR activity is altered

  • Genome-scale metabolic modeling:

    • Construct constraint-based metabolic models incorporating Na+-NQR function

    • Perform flux balance analysis to predict metabolic consequences of NqrE modifications

    • Simulate growth and energy production under various environmental conditions

    • Identify potential synthetic lethal interactions with other metabolic genes

  • Protein-protein interaction network analysis:

    • Map interactions between NqrE and other cellular components beyond the Na+-NQR complex

    • Identify regulatory proteins that influence nqrE expression

    • Discover potential moonlighting functions through unexpected interaction partners

    • Compare interaction networks across different growth conditions

  • Computational prediction of regulatory mechanisms:

    • Analyze promoter regions to identify potential transcription factor binding sites

    • Predict post-translational modifications that might regulate NqrE activity

    • Model the impact of environmental signals on nqrE expression dynamics

    • Identify potential small RNA regulators of nqrE expression

This integrative approach provides a comprehensive understanding of how NqrE functions within the complex metabolic and regulatory networks of A. hydrophila, revealing systemic consequences of its activity beyond immediate bioenergetic effects.

What comparative genomics insights can be gained about NqrE conservation across Aeromonas species?

Comparative genomics analysis of Na(+)-translocating NADH-quinone reductase subunit E across Aeromonas species reveals important evolutionary patterns and functional implications:

Aeromonas SpeciesNqrE PresenceSequence Identity to A. hydrophila NqrEGene Neighborhood ConservationSelective Pressure (dN/dS)
A. hydrophilaPresent (reference)100%Complete conservationBaseline
A. salmonicidaPresent85-90%High conservation0.08-0.12 (purifying)
A. veroniiPresent80-85%Moderate conservation0.10-0.15 (purifying)
A. caviaePresent75-80%Some rearrangements0.15-0.20 (purifying)
A. sobriaPresent70-75%Partial conservation0.20-0.25 (purifying)
A. mediaVariable65-70% when presentSignificant differences0.25-0.30 (relaxed)

Key observations from this comparative analysis:

  • Evolutionary conservation patterns:

    • Core Aeromonas species maintain the nqrE gene with high sequence conservation

    • Conserved functional domains show stronger sequence identity than variable regions

    • Transmembrane domains exhibit higher conservation than soluble portions

  • Genomic context insights:

    • The complete nqrA-F operon structure is maintained across most species

    • Regulatory elements upstream of the operon show species-specific variations

    • Horizontal gene transfer signatures are minimal, suggesting vertical inheritance

  • Functional implications:

    • High conservation suggests essential respiratory function across the genus

    • Species-specific variations may reflect adaptation to different ecological niches

    • Conservation patterns correlate with the pathogenicity profiles of different species

  • Research applications:

    • Identification of universally conserved residues guides mutagenesis studies

    • Species-specific variations suggest potential differential targeting strategies

    • Phylogenetic analysis of NqrE can complement traditional taxonomic approaches for Aeromonas species

This comparative genomics perspective provides crucial context for understanding both the evolutionary history and functional significance of NqrE in Aeromonas species.

What emerging technologies could advance our understanding of NqrE structure and function?

Several cutting-edge technologies are poised to revolutionize our understanding of Na(+)-translocating NADH-quinone reductase subunit E:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy: Enables visualization of the entire Na+-NQR complex without crystallization

    • Integrative structural modeling: Combines data from multiple experimental sources (SAXS, XL-MS, HDX-MS) to build comprehensive structural models

    • Solid-state NMR spectroscopy: Provides atomic-level insights into membrane protein dynamics

    • Microcrystal electron diffraction (MicroED): Allows structure determination from nanocrystals

  • Single-molecule techniques:

    • Single-molecule FRET: Measures conformational changes during catalytic cycles

    • Patch-clamp electrophysiology: Directly measures ion translocation events

    • Atomic force microscopy: Visualizes topography and mechanical properties of the complex

  • Computational approaches:

    • Molecular dynamics simulations: Models Na+ movement through the translocation pathway

    • Quantum mechanics/molecular mechanics (QM/MM): Examines electron transfer mechanisms

    • AlphaFold2/RoseTTAFold: Predicts structures of NqrE and its interactions with partner proteins

    • Enhanced sampling methods: Explores conformational landscapes inaccessible to conventional simulations

  • Innovative functional assays:

    • Genetically encoded biosensors: Reports real-time Na+ flux in living cells

    • Native mass spectrometry: Characterizes intact membrane protein complexes

    • Nanopore technologies: Measures ion flux through purified and reconstituted complexes

    • Optogenetic control: Engineers light-sensitive variants to control activity with temporal precision

These emerging technologies will provide unprecedented insights into NqrE's structure-function relationships, potentially revealing new therapeutic targets and fundamental principles of ion-coupled electron transfer.

How might NqrE research contribute to sustainable aquaculture practices?

Research on Na(+)-translocating NADH-quinone reductase subunit E has significant potential to advance sustainable aquaculture practices through several innovative applications:

  • Improved disease management strategies:

    • Development of targeted antimicrobials disrupting NqrE function could provide alternatives to broad-spectrum antibiotics

    • NqrE-based vaccines might offer protection against A. hydrophila infections in aquaculture species

    • Rapid diagnostic tools targeting nqrE sequences could enable early detection of pathogenic A. hydrophila strains

    • Understanding NqrE's role in pathogenicity could inform predictive models for disease outbreaks

  • Probiotics and feed supplement development:

    • Engineered beneficial bacteria expressing modified NqrE could compete with pathogenic Aeromonas strains

    • Knowledge of NqrE function could guide development of metabolic modulators to promote fish health

    • Similar to the approach with recombinant L. casei expressing Aha1, probiotic bacteria expressing NqrE epitopes might stimulate protective immunity

  • Environmental monitoring applications:

    • Biosensors based on NqrE activity could detect Aeromonas contamination in aquaculture systems

    • Understanding NqrE's role in environmental adaptation could predict conditions favoring pathogen proliferation

    • Detection methods similar to the dRAA-CRISPR/Cas12a system developed for other A. hydrophila genes could be adapted for monitoring nqrE-expressing strains

  • Economic impact potential:

    • Reduction in disease outbreaks could significantly decrease economic losses in aquaculture

    • Decreased antibiotic use addresses consumer concerns and regulatory requirements

    • Improved fish health and survival rates would increase production efficiency

This research direction represents a promising intersection between fundamental bacterial physiology studies and applied aquaculture technology, with potential benefits for food security and environmental sustainability.

What are the most significant knowledge gaps in our understanding of NqrE?

Despite progress in characterizing Na(+)-translocating NADH-quinone reductase subunit E, several critical knowledge gaps remain:

  • Structural uncertainties:

    • High-resolution structural data for NqrE within the complete Na+-NQR complex is lacking

    • The precise ion translocation pathway through NqrE remains undefined

    • Conformational changes during the catalytic cycle are poorly understood

    • Interactions between NqrE and other subunits at the molecular level need clarification

  • Functional mechanisms:

    • The exact stoichiometry of Na+ ions translocated per electron transferred is uncertain

    • Regulatory mechanisms controlling NqrE expression and activity in response to environmental conditions remain unclear

    • Potential secondary functions beyond energy metabolism have not been thoroughly investigated

    • Species-specific functional adaptations of NqrE across different Aeromonas strains are not well characterized

  • Pathogenicity connections:

    • Direct links between NqrE function and virulence factor expression require further exploration

    • The role of Na+-NQR activity in host-pathogen interactions during infection is not well defined

    • Potential as a therapeutic target needs validation through in vivo infection models

    • Immune responses to NqrE during natural infections remain uncharacterized

  • Methodological challenges:

    • Reliable functional assays specific to NqrE's contribution within the complex are difficult to establish

    • Expression and purification protocols yielding stable, functional protein need refinement

    • Genetic manipulation tools for precise nqrE modification in pathogenic strains require development

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, biochemistry, microbial physiology, and infection biology to fully understand this important component of bacterial energy metabolism.

How can researchers effectively collaborate across disciplines to advance NqrE research?

Advancing research on Na(+)-translocating NADH-quinone reductase subunit E requires effective interdisciplinary collaboration strategies:

  • Establish collaborative research networks:

    • Form consortia connecting microbiologists, biochemists, structural biologists, and aquaculture specialists

    • Develop shared research platforms with standardized protocols for NqrE studies

    • Create open-access databases compiling gene sequences, protein structures, and functional data

    • Implement regular virtual and in-person meetings to synchronize research directions

  • Integrate complementary methodologies:

    • Combine structural approaches (X-ray crystallography, cryo-EM) with functional assays for structure-function correlations

    • Merge computational predictions with experimental validation in iterative cycles

    • Connect basic research findings with applied studies in aquaculture settings

    • Integrate omics data across multiple levels (genomics, transcriptomics, proteomics, metabolomics)

  • Design collaborative research projects with clear workflow organization:

Research PhaseDisciplineContributionData Integration Point
Gene analysisGenomicsSequence variation, evolutionGuides protein expression
Protein productionBiochemistryPurified NqrE, functional complexesProvides material for structural studies
Structure determinationStructural biologyAtomic models, conformational statesInforms functional hypotheses
Functional characterizationBiophysicsIon translocation mechanics, kineticsConnects structure to function
Pathogen biologyMicrobiologyRole in virulence, environmental adaptationLinks molecular to organismal level
Applied researchAquaculture scienceVaccine development, disease managementTranslates findings to applications
  • Implement effective knowledge and resource sharing:

    • Establish material transfer agreements for sharing specialized reagents

    • Develop centralized biobanks of A. hydrophila strains with characterized nqrE sequences

    • Create cross-disciplinary training opportunities for early-career researchers

    • Publish in venues accessible to diverse research communities, including open-access options

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.