Recombinant Aeromonas hydrophila subsp. hydrophila NADH-quinone oxidoreductase subunit K (nuoK)

What is NADH-quinone oxidoreductase subunit K (nuoK) in Aeromonas hydrophila?

NADH-quinone oxidoreductase subunit K (nuoK) is a transmembrane protein component of Complex I in the respiratory chain of Aeromonas hydrophila. It consists of 102 amino acids with the sequence: MNGIPMEHGLLLAAVLFCIGLCGLLIRRNLLFILMSIEIMMNASALAFVVAGSRWAQADGQIMYILVISLAAAEASIGLALLLLLYRRYHTLNVDTVSEMRG . The protein contains multiple hydrophobic regions consistent with its function as a membrane protein, and is essential for electron transport during cellular respiration. As part of the NADH dehydrogenase complex, nuoK contributes to energy production in this facultatively anaerobic bacterium .

What are the optimal conditions for expressing recombinant Aeromonas hydrophila nuoK?

Successful expression of recombinant nuoK requires careful optimization due to its transmembrane nature. Based on proven protocols:

Recommended expression system:

• Host: E. coli BL21(DE3) strain

• Vector: pET system with His-tag for purification

• Temperature: 25-30°C (lower temperatures reduce aggregation of membrane proteins)

• Induction: 0.1-0.5 mM IPTG for gentle induction

Expression optimization parameters:

Methodological approach: Researchers should use a factorial design to systematically test combinations of these parameters, followed by SDS-PAGE and western blotting to verify expression levels. For membrane proteins like nuoK, detergent screening is also crucial for solubilization after expression .

How can researchers design experiments to investigate nuoK function in respiratory metabolism?

Experimental design framework:

• Baseline characterization:

  • Create nuoK knockout mutants using homologous recombination similar to methods used for other A. hydrophila genes

  • Compare growth curves of wild-type and ΔnuoK strains under aerobic and anaerobic conditions

  • Measure oxygen consumption rates using respirometry

• Complementation studies:

  • Reintroduce wild-type and mutated nuoK genes to verify phenotype restoration

  • Perform site-directed mutagenesis on conserved amino acid residues to identify critical functional domains

• Respiratory chain activity:

  • Measure NADH dehydrogenase activity in membrane fractions

  • Analyze proton pumping efficiency using pH-sensitive fluorescent dyes

  • Evaluate membrane potential using fluorescent probes

Control considerations:

• Include positive controls (known respiratory inhibitors)

• Use non-targeting mutations in nuoK as negative controls

• Conduct parallel experiments with other respiratory complex components

This systematic approach allows for rigorous testing of nuoK function while controlling for experimental variables that might affect respiratory metabolism measurements .

How does nuoK contribute to Aeromonas hydrophila pathogenicity and survival in different environmental conditions?

While direct evidence for nuoK's role in pathogenicity is limited, energy metabolism is fundamental to bacterial virulence and environmental adaptation. A comprehensive investigation requires:

Virulence model experiments:

• Compare virulence of wild-type and ΔnuoK strains in fish or cell culture models

• Measure bacterial survival in macrophages (similar to methods used for nuclease virulence factor studies)

• Assess competitive indices in vivo to determine survival advantages

Environmental adaptation studies:

• Test growth under different oxygen tensions, temperatures, and pH conditions

• Evaluate biofilm formation capacity (a known survival mechanism for A. hydrophila)

• Measure expression levels of nuoK under different environmental stresses

Methodological approach: Researchers should employ a multifaceted experimental design that combines in vitro, ex vivo, and in vivo models to comprehensively assess nuoK's contribution to pathogenicity .

What approaches should be used to resolve contradictions in nuoK functional data?

When conflicting data arise regarding nuoK function, researchers should implement a structured contradiction resolution framework:

• Systematic analysis of experimental variables:

  • Compile all experimental conditions from contradictory studies

  • Identify differences in strain backgrounds, growth conditions, and assay methods

  • Replicate key experiments with standardized protocols

• Implement time-aware fact tracking:

  • Document the validity intervals for each contradictory finding

  • Determine if apparent contradictions result from temporal dynamics

  • Apply contradiction detection algorithms to identify true inconsistencies

• Resolve contradictions through targeted experiments:

  • Design experiments specifically addressing points of contradiction

  • Use multiple complementary techniques to measure the same parameter

  • Consider strain-specific or condition-specific effects

Example contradiction framework:

This approach ensures methodical resolution of contradictory data while maintaining scientific rigor .

What methods are recommended for analyzing the structure-function relationship of nuoK?

Understanding the structure-function relationship of nuoK requires multiple complementary approaches:

Structural analysis methods:

• Computational modeling:

  • Homology modeling based on related proteins with known structures

  • Molecular dynamics simulations to predict membrane interactions

  • Identification of conserved domains through multiple sequence alignment

• Experimental structure determination:

  • Circular dichroism spectroscopy to assess secondary structure content

  • NMR spectroscopy for structure determination (challenging for membrane proteins)

  • Cryo-EM for structure determination within the larger Complex I

Functional mapping approach:

• Generate a library of point mutations targeting predicted functional domains

• Express mutant proteins and assess activity in complementation assays

• Correlate structural changes with functional outcomes

Methodological considerations: Due to the technical challenges of working with membrane proteins, researchers should employ a combinatorial approach, using computational predictions to guide targeted experimental studies .

How can researchers detect and measure nuoK protein-protein interactions within Complex I?

Investigating nuoK interactions within the NADH-quinone oxidoreductase complex requires specialized techniques for membrane protein complexes:

Recommended approaches:

• Crosslinking studies:

  • Chemical crosslinking followed by mass spectrometry

  • Site-specific incorporation of photo-activatable crosslinkers

  • Analysis of crosslinked products by SDS-PAGE and western blotting

• Co-immunoprecipitation:

  • Use antibodies against nuoK or epitope-tagged versions

  • Validate interactions with reciprocal co-immunoprecipitation

  • Identify interacting partners by mass spectrometry

• Förster Resonance Energy Transfer (FRET):

  • Generate fluorescently labeled nuoK and potential interaction partners

  • Measure FRET efficiency to determine proximity and interaction

  • Perform competition assays to validate specificity

Validation approach: Use a systematic experimental design with appropriate controls to distinguish specific from non-specific interactions. Multiple complementary techniques should be employed to build a comprehensive interaction map, as no single method provides complete information .

What are the best methods for detecting Aeromonas hydrophila and its nuoK gene in environmental samples?

Detecting A. hydrophila and specifically the nuoK gene in environmental samples requires a multi-step approach:

Bacterial isolation and identification:

• Use selective media like Rimler-Shotts agar for initial isolation

• Confirm through biochemical tests (oxidase, catalase positive; glucose fermentation; nitrate reduction)

• Molecular confirmation through 16S rRNA sequencing

nuoK gene detection:

• PCR-based methods:

  • Design specific primers targeting conserved regions of nuoK

  • Use quantitative PCR for abundance estimation

  • Implement nested PCR for increased sensitivity in complex samples

• Electronic nose technology:

  • While not specific to nuoK, electronic nose systems can detect A. hydrophila volatile production patterns

  • Sensitivity reported at 9.6 × 10² CFU/mL within 2 hours

  • Can be used as a rapid screening method before molecular confirmation

Environmental sample processing protocol:

• Filter water samples through 0.45 μm filters

• Enrich in tryptic soy broth at 28-30°C for 24-36 hours

• Extract DNA using commercial kits optimized for environmental samples

• Perform PCR detection with appropriate controls

This sequential approach maximizes detection sensitivity while maintaining specificity for A. hydrophila and the nuoK gene .

How should researchers interpret changes in nuoK expression under different environmental stressors?

Accurate interpretation of nuoK expression changes requires rigorous experimental design and data analysis:

Experimental design considerations:

• Include proper time-course measurements to capture expression dynamics

• Test multiple stressors (temperature, pH, oxygen levels, antimicrobials)

• Use appropriate reference genes for normalization

• Include biological and technical replicates

Data analysis framework:

• Apply statistical methods appropriate for expression data (ANOVA, t-tests)

• Consider both magnitude and timing of expression changes

• Correlate expression changes with physiological responses

• Compare with other respiratory chain components to identify coordinated responses

Interpretation guidelines:

Researchers should avoid over-interpretation of expression data alone and always validate with functional assays that directly measure respiratory activity .