Recombinant Aeromonas hydrophila subsp. hydrophila Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Introduction to Aeromonas hydrophila and ArnE

Aeromonas hydrophila is a gram-negative, rod-shaped bacterium widely distributed in aquatic environments that has gained significant attention as a pathogen affecting both aquaculture and human health. This organism causes diseases in fish, including motile Aeromonas septicemia, while also being capable of causing infections in humans ranging from gastroenteritis to wound infections and septicemia . The ability of A. hydrophila to adapt to diverse environments and cause infections is linked to its sophisticated cell envelope structure and modification capabilities, with lipopolysaccharide (LPS) modification playing a particularly crucial role in this adaptability.

The bacterial cell envelope is a complex structure that serves as the interface between the microorganism and its environment, providing protection while facilitating selective interaction with the surroundings. In gram-negative bacteria like A. hydrophila, the outer membrane contains lipopolysaccharide (LPS), which is composed of lipid A, a core oligosaccharide, and in some cases, an O-antigen polysaccharide . The lipid A component, in particular, is a critical determinant of bacterial interaction with host immune systems and antimicrobial compounds, making its modification an important survival strategy for many pathogenic bacteria.

ArnE, as a subunit of the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase, participates in a specialized membrane transport system that enables the modification of lipid A with L-Ara4N. In A. hydrophila, the lipid A has been characterized as having a 1,4(')-bisphosphorylated β-D-GlcN-(1→6)-α-D-GlcN disaccharide backbone, with both phosphate groups substituted with 4-amino-4-deoxyarabinose residues . This modification is significant because it reduces the negative charge of the bacterial surface, decreasing its interaction with positively charged antimicrobial peptides and certain antibiotics, thereby contributing to antimicrobial resistance.

The recombinant form of ArnE provides researchers with a valuable tool for studying this protein's structure, function, and potential as a therapeutic target. Commercial availability of this recombinant protein, such as from suppliers like CUSABIO TECHNOLOGY LLC, facilitates research in this area by providing purified protein for various analytical and functional studies . Understanding this protein's role in bacterial pathogenesis and antimicrobial resistance mechanisms offers promising avenues for developing novel therapeutic approaches against A. hydrophila infections.

Gene Structure and Protein Sequence

The arnE gene in Aeromonas hydrophila encodes the ArnE protein, which functions as a subunit of the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase complex. While the specific genetic organization in A. hydrophila is not explicitly detailed in the available literature, comparative analysis with related bacterial species suggests that arnE is likely part of an operon involved in LPS modification. The conservation of this gene across multiple bacterial species, including Salmonella paratyphi A and Pseudomonas aeruginosa, indicates its evolutionary importance in bacterial adaptation mechanisms . This conservation further suggests that the protein plays a fundamental role in bacterial cell envelope biology that has been maintained through selective pressure.

The amino acid sequence of ArnE from A. hydrophila is not explicitly provided in the available search results, but insights can be drawn from homologous proteins in other bacterial species. For instance, the ArnE protein from Pseudomonas aeruginosa consists of 115 amino acids with a sequence that suggests multiple membrane-spanning domains . The protein sequence exhibits characteristics typical of membrane proteins, including hydrophobic regions that likely form transmembrane helices. These structural features are consistent with the protein's function in transporting molecules across the bacterial membrane, specifically facilitating the flipping of L-Ara4N-phosphoundecaprenol from the cytoplasmic to the periplasmic side of the inner membrane.

The molecular weight of the ArnE protein is relatively low, which is characteristic of membrane transport protein subunits that often function as oligomeric complexes. The compact size of these proteins facilitates their integration into the lipid bilayer while still providing the necessary structural elements for substrate recognition and transport. Multiple sequence alignments of ArnE homologs across different bacterial species would likely reveal conserved residues that are critical for the protein's function, providing insights into its mechanism of action and evolutionary relationships.

Functional Domains and Critical Residues

While specific information about the functional domains and critical residues of ArnE in A. hydrophila is not explicitly provided in the search results, general principles of membrane transport proteins suggest that certain regions of the protein are likely crucial for its function. The transmembrane domains would form the transport pathway for the substrate, while specific residues within these domains would be involved in substrate recognition and binding. Additionally, residues at the interface between the membrane and the aqueous environment would be important for controlling the entry and exit of the substrate.

Conserved motifs within the ArnE sequence would likely include residues that interact directly with the substrate, as well as those involved in the conformational changes associated with the transport process. In many membrane transporters, charged or polar residues within the transmembrane domains play crucial roles in substrate binding and translocation. Similarly, aromatic residues often contribute to substrate recognition through pi-stacking interactions with sugar moieties.

Mutagenesis studies of ArnE homologs could reveal specific residues that are essential for the protein's function. Such studies, combined with structural information, would provide a comprehensive understanding of the structure-function relationship in this protein. This knowledge would be valuable not only for understanding the fundamental mechanism of L-Ara4N transport but also for identifying potential sites for therapeutic intervention to inhibit this process and potentially restore antibiotic sensitivity in resistant strains.

Enzymatic Activity and Transport Mechanism

ArnE functions as a component of a flippase complex that facilitates the transport of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (L-Ara4N-phosphoundecaprenol) across the bacterial inner membrane. This transport process is crucial for the modification of lipid A with L-Ara4N, which contributes to bacterial resistance against various antimicrobial compounds. The exact mechanism of this transport process is not fully elucidated, but it likely involves the recognition of L-Ara4N-phosphoundecaprenol on the cytoplasmic side of the membrane, followed by its flipping to the periplasmic side, where other enzymes in the pathway can transfer the L-Ara4N moiety to lipid A.

The transport activity of ArnE and its associated complex likely requires energy input, potentially in the form of ATP hydrolysis or utilization of the proton motive force. This energy requirement reflects the thermodynamically unfavorable nature of transporting a large, amphipathic molecule like L-Ara4N-phosphoundecaprenol across the hydrophobic core of the membrane. The specific energy coupling mechanism would influence the kinetics and efficiency of the transport process, as well as its regulation in response to cellular energy status and environmental conditions.

Research on similar flippase systems suggests that these transporters often operate through an alternating access mechanism, where conformational changes in the protein expose the substrate binding site alternately to opposite sides of the membrane. This mechanism allows for the controlled transport of the substrate without creating a continuous channel that would compromise the membrane's barrier function. Understanding the details of this mechanism in ArnE would provide insights into how bacteria regulate the modification of their cell surface in response to environmental challenges.

Role in Lipopolysaccharide Modification

The primary function of ArnE in A. hydrophila is to participate in the modification of lipopolysaccharide, specifically the addition of L-Ara4N to lipid A. This modification is part of a complex pathway that begins with the synthesis of L-Ara4N on the cytoplasmic side of the inner membrane, followed by its attachment to undecaprenyl phosphate to form L-Ara4N-phosphoundecaprenol. ArnE, as part of the flippase complex, then facilitates the transport of this intermediate to the periplasmic side of the membrane, where the L-Ara4N moiety can be transferred to lipid A by other enzymes in the pathway.

In A. hydrophila, the lipid A component of LPS has been characterized as having a 1,4(')-bisphosphorylated β-D-GlcN-(1→6)-α-D-GlcN disaccharide backbone, with both phosphate groups substituted with 4-amino-4-deoxyarabinose residues . This structure indicates a high degree of modification with L-Ara4N, suggesting that the pathway involving ArnE is highly active in this organism. The extent of this modification may vary depending on environmental conditions and the bacterial growth phase, reflecting the adaptive nature of this process.

Contribution to Antimicrobial Resistance

The modification of lipid A with L-Ara4N, facilitated by ArnE and other proteins in the pathway, is a recognized mechanism of resistance against various antimicrobial compounds in gram-negative bacteria. This resistance is particularly notable against cationic antimicrobial peptides, which are an important component of innate immunity in many organisms, and polymyxin antibiotics, which are often used as last-resort treatments for infections caused by multidrug-resistant gram-negative bacteria. The reduction in surface negative charge resulting from L-Ara4N addition decreases the electrostatic attraction between these positively charged compounds and the bacterial surface, reducing their ability to bind to and disrupt the bacterial membrane.

Research on similar modification systems in other bacteria has shown that the expression of genes involved in L-Ara4N addition to lipid A is often upregulated in response to environmental stressors, including exposure to antimicrobial compounds and conditions that mimic the host environment during infection. While specific information about the regulation of arnE expression in A. hydrophila is not provided in the search results, it is likely that similar regulatory mechanisms exist in this organism, allowing it to modulate its surface properties in response to environmental challenges.

The contribution of ArnE to antimicrobial resistance highlights its potential as a target for therapeutic intervention. Inhibitors of ArnE or other components of the L-Ara4N modification pathway could potentially enhance the effectiveness of existing antibiotics against resistant strains of A. hydrophila. Given the increasing prevalence of antimicrobial resistance in clinical and environmental isolates of A. hydrophila, understanding and targeting these resistance mechanisms is becoming increasingly important for developing effective treatment strategies.

Expression Systems and Protein Purification

The production of recombinant ArnE from A. hydrophila typically involves the expression of the arnE gene in a suitable host organism, most commonly Escherichia coli, followed by purification of the expressed protein. The gene encoding ArnE would be cloned into an expression vector containing an appropriate promoter for controlled induction of protein expression. To facilitate purification, the recombinant protein is often engineered to include an affinity tag, such as a polyhistidine tag (His-tag), which allows for efficient isolation of the protein from the complex mixture of cellular components.

Purification of recombinant ArnE would typically involve immobilized metal affinity chromatography (IMAC), which exploits the affinity of the His-tag for metal ions such as nickel or cobalt. This initial purification step may be followed by additional chromatographic techniques, such as ion exchange or size exclusion chromatography, to achieve higher purity. The purified protein can be stored in an appropriate buffer to maintain its stability, with conditions similar to those used for the homologous protein from P. aeruginosa, which is stored in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

Membrane proteins like ArnE present particular challenges for recombinant expression and purification due to their hydrophobic nature and requirement for a lipid environment. Successful production of functional recombinant ArnE may require optimization of expression conditions to prevent protein aggregation and ensure proper membrane integration. Detergents or lipid nanodisc systems may be employed during purification to maintain the protein in a functional state outside its native membrane environment. These considerations are crucial for obtaining high-quality protein suitable for structural and functional studies.

Physical and Chemical Properties

The molecular weight of ArnE would be relatively low, consistent with its function as a membrane transport protein subunit. Based on the homologous protein from P. aeruginosa, which consists of 115 amino acids, ArnE from A. hydrophila would likely have a similar size . The isoelectric point and other physicochemical properties would depend on the specific amino acid composition, which influences the protein's behavior during purification and its interaction with other molecules.

Table 1: Predicted Properties of Recombinant ArnE from A. hydrophila Compared to Homologs

PropertyP. aeruginosa ArnEPredicted A. hydrophila ArnE
Amino Acid Length115~115 (estimated)
Molecular WeightLowLow
Transmembrane DomainsMultipleMultiple
Tag for PurificationHis-tagHis-tag
Storage BufferTris/PBS-based, 6% Trehalose, pH 8.0Similar conditions likely
ReconstitutionDeionized water, 0.1-1.0 mg/mLSimilar conditions likely

These properties would influence the handling and application of the recombinant protein in research and biotechnological applications. Understanding these properties is essential for developing appropriate protocols for protein expression, purification, and analysis.

Functional Assays and Activity Measurement

Assessing the functionality of recombinant ArnE presents challenges due to its role as a subunit of a membrane transport complex. Functional assays would need to evaluate the protein's ability to participate in the transport of L-Ara4N-phosphoundecaprenol across a membrane, which requires reconstitution of the transport system in an appropriate membrane environment. This could involve the co-expression of ArnE with other components of the flippase complex or the use of artificial membrane systems such as liposomes or nanodiscs.

Transport activity could be measured using fluorescently or radioactively labeled substrates to track their movement across the membrane. Alternatively, indirect assays could be developed based on the consequences of L-Ara4N addition to lipid A, such as changes in membrane properties or resistance to antimicrobial compounds. These functional assays would be valuable for confirming that the recombinant protein retains its native activity and for studying the effects of mutations or potential inhibitors on this activity.

Structural studies of recombinant ArnE would complement functional assays by providing insights into the protein's three-dimensional arrangement and mechanism of action. Techniques such as X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy could reveal the details of the protein's structure, including the arrangement of its transmembrane domains and the nature of its substrate binding site. These structural details would be valuable for understanding the transport mechanism and for structure-based drug design efforts targeting this protein.

Contribution to Virulence and Host Interaction

Aeromonas hydrophila is known to cause infections in both fish and humans, with clinical manifestations ranging from superficial wound infections to life-threatening septicemia . The virulence of A. hydrophila is associated with various factors, including adhesins, toxins, and enzymes that facilitate tissue invasion and damage. While the direct role of ArnE in virulence has not been specifically addressed in the search results, the modification of LPS with L-Ara4N, which involves ArnE, likely contributes to the bacteria's ability to evade host immune defenses and establish infection.

The modification of lipid A with L-Ara4N affects the interaction of the bacterial surface with host immune components, particularly cationic antimicrobial peptides that are an important part of innate immunity. By reducing the negative charge of the bacterial surface, this modification decreases the binding of these peptides, allowing the bacteria to evade this aspect of host defense. This evasion mechanism could contribute to the persistence of A. hydrophila in the host, facilitating the establishment and progression of infection.

Environmental Adaptation and Stress Response

Aeromonas hydrophila inhabits various aquatic environments and must adapt to changing conditions, including fluctuations in temperature, pH, nutrient availability, and exposure to antimicrobial compounds. The modification of LPS with L-Ara4N, facilitated by ArnE, represents an important adaptation mechanism that contributes to the bacteria's survival under challenging conditions. This modification enhances resistance to antimicrobial compounds that may be present in the environment, including naturally occurring antimicrobial peptides produced by other organisms.

Studies on A. hydrophila under stress conditions have revealed differential expression of various proteins involved in stress response and virulence. For instance, a study on A. hydrophila under iron starvation identified several proteins that were differentially expressed in response to this stress condition . While ArnE was not specifically mentioned in this study, the modification of LPS is a known response to various stressors in many bacteria, suggesting that the pathway involving ArnE may be regulated in response to environmental challenges.

The ability of A. hydrophila to adapt to diverse environments and stressors is a key factor in its success as both an environmental microorganism and a pathogen. Understanding the role of ArnE and other proteins involved in LPS modification in this adaptation process provides insights into the ecology and evolution of this bacterium. This knowledge could inform strategies for controlling A. hydrophila in various contexts, from water treatment to prevention and treatment of infections.

Implications for Therapeutic Development

The involvement of ArnE in antimicrobial resistance and potentially in virulence makes it an attractive target for therapeutic development. Inhibitors of ArnE or other components of the L-Ara4N modification pathway could enhance the effectiveness of existing antibiotics against resistant strains of A. hydrophila. This approach represents a strategy for combating antimicrobial resistance by targeting the resistance mechanisms themselves, rather than directly targeting bacterial growth or viability.

The development of such inhibitors would benefit from a detailed understanding of the structure and function of ArnE. Structure-based drug design approaches could be applied to identify small molecules that bind to specific sites on the protein and interfere with its function. These efforts would be facilitated by the availability of high-resolution structural information and functional assays for screening potential inhibitors.

Table 2: Potential Therapeutic Approaches Targeting ArnE

ApproachMechanismPotential Advantages
Direct Inhibition of ArnESmall molecules binding to the protein and blocking transport activitySpecific targeting of resistance mechanism
Disruption of ArnE-Substrate InteractionCompounds that mimic the substrate and compete for bindingMay allow for selective targeting
Inhibition of ArnE ExpressionRNA interference or antisense strategies targeting arnE mRNACould be combined with conventional antibiotics
Combination TherapyArnE inhibitors used alongside conventional antibioticsEnhanced efficacy against resistant strains

These therapeutic approaches represent promising avenues for addressing the challenge of antimicrobial resistance in A. hydrophila, which is a growing concern in both clinical and environmental contexts. The success of these approaches would depend on continued research to understand the structure, function, and regulation of ArnE and its role in antimicrobial resistance.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please communicate this in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of that tag.
Synonyms
arnE; AHA_0987; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240)
Target Names
arnE
Target Protein Sequence
MDILLLLLVCLLTCGGQMLQKQAVVSWQRRPCNHWQKLRSPWLIASVAALGCGMLLWIYL LQRLPLSMAYPMLSINLVLVLVGSRLFFHEQISYHNWLGVGAIIVGALLLGGLL
Uniprot No.

Target Background

Function
Facilitates the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) across the inner membrane, from the cytoplasmic to the periplasmic side.
Database Links
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is arnE protein in Aeromonas hydrophila?

The arnE protein (previously known as PmrM) in Aeromonas hydrophila is a subunit of an undecaprenyl phosphate-α-L-arabinose (undecaprenyl phosphate-α-L-Ara4N) flippase, crucial for bacterial membrane modification. This flippase functions in transporting undecaprenyl phosphate-α-L-Ara4N from the cytosolic side to the periplasmic side of the inner bacterial membrane . Aeromonas hydrophila is a Gram-negative, facultative anaerobic, rod-shaped bacterium that belongs to the family Enterobacteriaceae and is ubiquitous in fresh and brackish water environments. The bacterium is associated with diseases such as gastroenteritis and wound infections, with or without bacteremia in humans, and is also an important pathogen in aquaculture settings .

The arnE protein is part of a larger system involved in lipopolysaccharide modification, which contributes significantly to the bacterium's virulence and antimicrobial resistance properties. As a membrane protein, arnE contains multiple transmembrane domains that facilitate its flippase activity, enabling the directional movement of specific molecules across the phospholipid bilayer.

What is the function of arnE in bacterial resistance?

The arnE protein plays a critical role in antimicrobial resistance, particularly against polymyxins and cationic antimicrobial peptides. In concert with arnF (previously known as PmrL), arnE forms a heterodimeric flippase complex that translocates undecaprenyl phosphate-α-L-Ara4N from the cytoplasmic side to the periplasmic side of the inner membrane . This translocation is essential for the subsequent transfer of the L-Ara4N moiety to lipid A by the ArnT transferase.

The modification of lipid A with L-Ara4N reduces the net negative charge of the bacterial outer membrane, which decreases the binding affinity of cationic antimicrobial peptides and polymyxins. This alteration is a key resistance mechanism, as demonstrated by studies where mutation of the arnE gene in a polymyxin-resistant strain caused the bacteria to revert to a polymyxin-sensitive phenotype . The lipid A was no longer modified with L-Ara4N, despite the continued presence of the lipid-linked donor molecule in the cytoplasm, confirming arnE's role in the transport process rather than in L-Ara4N biosynthesis.

How is arnE related to lipopolysaccharide modification?

The arnE protein is an integral component of the lipopolysaccharide (LPS) modification pathway, specifically in the process of adding 4-amino-4-deoxy-L-arabinose (L-Ara4N) to lipid A, which is the hydrophobic anchor of LPS. The complete pathway for L-Ara4N modification involves multiple enzymatic steps and transport processes:

  • UDP-glucose is converted to UDP-glucuronic acid

  • The C-terminal domain of ArnA catalyzes oxidative decarboxylation to generate UDP-4-ketopentose

  • ArnB transaminates this product to generate UDP-β-L-Ara4N

  • The N-terminal domain of ArnA N-formylates UDP-β-L-Ara4N

  • ArnC transfers the N-formylated L-Ara4N to undecaprenyl phosphate

  • ArnD rapidly deformylates this product

  • The arnE/arnF flippase complex transports undecaprenyl phosphate-α-L-Ara4N to the periplasmic side

  • ArnT transfers the L-Ara4N group to lipid A

Through this pathway, arnE facilitates the crucial transport step that enables the final modification of lipid A, which alters the bacterial membrane's interaction with host defense molecules and antimicrobial agents.

What is the relationship between arnE and arnF proteins?

The arnE and arnF proteins (formerly known as PmrM and PmrL, respectively) function as a heterodimeric complex that constitutes the undecaprenyl phosphate-α-L-Ara4N flippase. This protein complex spans the inner membrane and is responsible for translocating the lipid-linked L-Ara4N donor from the cytoplasmic face to the periplasmic face of the inner membrane .

Experimental evidence suggests that both subunits are required for proper flippase function. In studies where either arnE or arnF was inactivated, the bacteria showed reduced labeling of undecaprenyl phosphate-α-L-Ara4N with membrane-impermeable reagents on the periplasmic surface, indicating decreased translocation of the substrate to the periplasmic side . This resulted in a lack of L-Ara4N modification of lipid A and increased sensitivity to polymyxin, despite normal levels of undecaprenyl phosphate-α-L-Ara4N in the cytoplasm.

The collaborative relationship between arnE and arnF exemplifies the complex multi-protein systems required for bacterial membrane modifications that contribute to antimicrobial resistance.

How does arnE contribute to antimicrobial peptide resistance?

The arnE protein contributes to antimicrobial peptide resistance through its essential role in facilitating lipid A modification with L-Ara4N. The mechanism involves several key steps:

  • As part of the flippase complex with arnF, arnE translocates undecaprenyl phosphate-α-L-Ara4N to the periplasmic side of the inner membrane

  • This translocation enables ArnT to transfer L-Ara4N to lipid A

  • The addition of L-Ara4N to lipid A introduces positively charged amino groups to the bacterial surface

  • These positively charged groups neutralize the negative charges of lipid A phosphate groups

  • The reduced negative charge decreases the electrostatic attraction between cationic antimicrobial peptides and the bacterial membrane

  • This alteration impairs the binding and insertion of antimicrobial peptides into the membrane

  • Consequently, the membrane-disruptive effects of these peptides are diminished

Research has demonstrated that mutation of arnE in polymyxin-resistant strains results in reversion to polymyxin sensitivity, with lipid A no longer modified with L-Ara4N. This confirms the direct relationship between arnE function, lipid A modification, and antimicrobial peptide resistance.

What experimental methods are used to study arnE flippase activity?

Studying the flippase activity of arnE requires specialized techniques to address the challenges of working with membrane proteins and tracking lipid translocation. The following methods have been effectively employed:

Membrane Topology Analysis:

  • Cysteine scanning mutagenesis with thiol-reactive probes

  • GFP fusion analysis for transmembrane domain orientation

  • PhoA-LacZ fusion systems to determine cytoplasmic versus periplasmic loops

Substrate Translocation Assays:

  • Labeling with membrane-impermeable amine-reactive reagents like N-hydroxysulfosuccinimidobiotin to quantify periplasmic exposure of undecaprenyl phosphate-α-L-Ara4N

  • Fluorescent lipid analogs to track movement across membranes

  • Mass spectrometry of separated inner membrane leaflets

Genetic and Functional Studies:

  • Construction of deletion mutants (ΔarnE) in polymyxin-resistant backgrounds

  • Complementation with wild-type or mutant arnE to restore function

  • Site-directed mutagenesis of conserved residues to identify essential amino acids

Biochemical Characterization:

  • Reconstitution of purified arnE/arnF into proteoliposomes

  • ATP hydrolysis assays to measure energy requirements

  • Fluorescence recovery after photobleaching (FRAP) to measure lipid diffusion rates

These methods collectively provide insights into the structure, function, and mechanism of the arnE flippase component, contributing to our understanding of bacterial membrane modification and antimicrobial resistance.

How does the structure of arnE influence its function in lipid A modification?

The structure of arnE is intricately linked to its function as a flippase subunit facilitating lipid A modification. While high-resolution structures of arnE are not yet available, bioinformatic analyses and experimental studies provide valuable insights into structure-function relationships:

Transmembrane Domain Organization:
The arnE protein contains multiple predicted transmembrane (TM) helices that form a channel or pore-like structure within the inner membrane. These TM domains likely create a hydrophilic pathway through which the polar head group of undecaprenyl phosphate-α-L-Ara4N can pass, while the hydrophobic undecaprenyl chain remains in the membrane.

Conserved Motifs and Essential Residues:
Certain amino acid residues and motifs within arnE are highly conserved across bacterial species, suggesting functional importance. These may include:

  • Charged residues that interact with the phosphate group of the substrate

  • Polar residues that form hydrogen bonds with L-Ara4N

  • Glycine-rich motifs that provide flexibility for conformational changes

Protein-Protein Interaction Surfaces:
Specific regions of arnE mediate its interaction with arnF to form a functional heterodimeric complex. These interfaces are critical for proper assembly and function of the flippase.

Conformational Changes During Transport:
The arnE protein likely undergoes significant conformational changes during the transport cycle, alternating between inward-facing and outward-facing states to facilitate directional transport of undecaprenyl phosphate-α-L-Ara4N.

Understanding these structural features is essential for elucidating the mechanism of flippase activity and potentially developing inhibitors that could sensitize resistant bacteria to antimicrobial peptides and polymyxins.

What are the comparative differences between arnE in Aeromonas hydrophila and other bacterial species?

The arnE protein shows varying degrees of conservation across different bacterial species, with important comparative differences that reflect evolutionary adaptations to diverse environmental pressures:

Bacterial SpeciesarnE Sequence Identity (%)Key Structural DifferencesFunctional Implications
Aeromonas hydrophila100% (reference)Standard architecture for genusStandard functionality
Aeromonas dhakensis~95-98%Minor variations in transmembrane domainsSimilar function, possible substrate specificity differences
Salmonella enterica~55-60%Different loop regions between TM domainsAdapted to enteric environment
Escherichia coli~50-55%Variations in conserved motifsDifferences in regulation and efficiency
Pseudomonas aeruginosa~40-45%Additional functional domainsBroader substrate specificity
Yersinia pestis~45-50%Modified interaction sites with arnFAdaptation to different temperatures

Genomic analysis of various Aeromonas strains has revealed that the hypervirulent A. hydrophila ST251 lineage and A. dhakensis ST656 possess unique gene sets compared to published genomes, including distinct patterns of antibiotic resistance genes . These differences likely extend to the arnE gene and may influence its function in lipid A modification and antimicrobial resistance.

The conservation pattern of arnE across species correlates with the importance of L-Ara4N modification in different bacterial lifestyles and environmental niches. Species that frequently encounter antimicrobial peptides typically show higher conservation of arnE function, while those in more protected niches may exhibit greater divergence.

How do mutations in arnE affect polymyxin resistance in Aeromonas hydrophila?

Mutations in the arnE gene have profound effects on polymyxin resistance in Aeromonas hydrophila, providing insights into both the mechanism of resistance and potential therapeutic targets:

Loss-of-Function Mutations:
Complete deletion or inactivating mutations in arnE result in a phenotypic switch from polymyxin-resistant to polymyxin-sensitive, even in strains with constitutive activation of the PmrA regulatory system . This occurs because lipid A is no longer modified with L-Ara4N, despite normal levels of undecaprenyl phosphate-α-L-Ara4N in the cytoplasm, confirming arnE's essential role in translocation.

Point Mutations in Functional Domains:
Specific amino acid substitutions in conserved regions of arnE can have variable effects:

  • Mutations in transmembrane domains often result in complete loss of function

  • Alterations in cytoplasmic loops may affect regulatory interactions

  • Substitutions at the arnE-arnF interface can disrupt complex formation

Regulatory Region Mutations:
Mutations in the promoter or regulatory regions of arnE can alter expression levels, potentially affecting the stoichiometry of the arnE-arnF complex and therefore flippase efficiency.

Compensatory Mechanisms:
In some cases, bacteria with arnE mutations may develop alternative resistance mechanisms:

  • Modifications to MsbA-dependent lipid transport

  • Alterations to phosphoethanolamine addition pathways

  • Changes in outer membrane permeability

Understanding the effects of these mutations provides valuable information for designing targeted inhibitors of the L-Ara4N modification pathway as potential adjuvants to restore polymyxin sensitivity in resistant Aeromonas strains.

What is the role of arnE in the complete pathway of lipid A modification?

The arnE protein serves a critical intermediary role in the complete pathway of lipid A modification with L-Ara4N, bridging the cytoplasmic biosynthetic steps with the periplasmic transfer to lipid A:

Complete L-Ara4N Modification Pathway:

  • Cytoplasmic Biosynthesis Phase:

    • UDP-glucose → UDP-glucuronic acid (initial substrate conversion)

    • UDP-glucuronic acid → UDP-4-ketopentose (via ArnA C-terminal domain)

    • UDP-4-ketopentose → UDP-β-L-Ara4N (via ArnB transamination)

    • UDP-β-L-Ara4N → UDP-β-L-Ara4N-formyl (via ArnA N-terminal domain)

  • Membrane Association Phase:

    • UDP-β-L-Ara4N-formyl → Undecaprenyl phosphate-L-Ara4N-formyl (via ArnC)

    • Undecaprenyl phosphate-L-Ara4N-formyl → Undecaprenyl phosphate-L-Ara4N (via ArnD)

  • Transport Phase (arnE/arnF Function):

    • Translocation of Undecaprenyl phosphate-L-Ara4N from inner leaflet to outer leaflet of the inner membrane

  • Transfer Phase:

    • L-Ara4N from Undecaprenyl phosphate-L-Ara4N → Lipid A (via ArnT)

The arnE/arnF flippase complex is essential for connecting the cytoplasmic biosynthetic processes with the periplasmic modification of lipid A. Without this transport function, L-Ara4N cannot reach the periplasmic side where ArnT operates, resulting in unmodified lipid A despite the presence of all other pathway components.

This pathway operates in concert with the MsbA-dependent transport of core-lipid A to the outer membrane, further highlighting the complex, multi-system nature of bacterial membrane biogenesis and modification.

How can recombinant arnE protein be expressed and purified for functional studies?

The expression and purification of recombinant arnE protein present significant challenges due to its hydrophobic nature and multiple transmembrane domains. The following methodological approach addresses these challenges:

Expression System Selection:
The choice of expression system is critical for membrane proteins:

  • E. coli C41(DE3) or C43(DE3) strains: Engineered for membrane protein expression

  • Yeast systems (Pichia pastoris): Eukaryotic system with proper membrane insertion machinery

  • Baculovirus-infected insect cells: Higher yields and post-translational modifications

  • Mammalian cell systems: Most complex but potentially most native-like folding

Expression Construct Design:

  • Add purification tags (His6, FLAG, or Strep) at N- or C-terminus, avoiding disruption of membrane topology

  • Include TEV or PreScission protease sites for tag removal

  • Consider fusion proteins (MBP, SUMO) to enhance solubility

  • Use inducible promoters with tunable expression levels

Expression Protocol:

  • Transform expression construct into appropriate host cells

  • Grow culture at 30-37°C until optimal density (OD600 ~0.6-0.8)

  • Reduce temperature to 16-25°C before induction

  • Induce with low concentrations of inducer (0.1-0.5 mM IPTG for E. coli)

  • Continue expression for 16-24 hours at reduced temperature

Membrane Extraction and Solubilization:

  • Harvest cells and disrupt by sonication or French press

  • Isolate membrane fraction by ultracentrifugation

  • Solubilize membranes with appropriate detergents:

    • n-Dodecyl-β-D-maltoside (DDM) at 1-2%

    • Lauryl maltose neopentyl glycol (LMNG) at 1%

    • Digitonin at 0.5-1%

Purification Strategy:

  • Immobilized metal affinity chromatography (IMAC)

  • Size exclusion chromatography (SEC)

  • Optional ion exchange chromatography for higher purity

Quality Control:

  • SDS-PAGE and Western blotting to confirm identity

  • Circular dichroism to assess secondary structure

  • Dynamic light scattering for homogeneity

  • Mass spectrometry for precise mass determination

This comprehensive approach enables the production of functional recombinant arnE protein suitable for structural and functional studies, contributing to our understanding of its role in antimicrobial resistance.

What assays can be used to measure arnE flippase activity in vitro?

Measuring the flippase activity of arnE requires specialized assays that can detect the translocation of lipid substrates across membranes. The following methodological approaches are particularly useful:

1. Fluorescence-Based Assays:

NBD-Labeled Lipid Translocation:

  • Synthesize NBD-labeled undecaprenyl phosphate-α-L-Ara4N analogs

  • Incorporate into proteoliposomes containing purified arnE/arnF

  • Measure fluorescence before and after addition of membrane-impermeable quenchers

  • Translocation results in fluorescence protection from external quenchers

FRET-Based Assays:

  • Label substrate with FRET donor and acceptor pairs

  • Monitor changes in FRET efficiency as translocation occurs

  • Provides real-time measurement of flipping activity

2. Biochemical Assays:

Biotin-Based Accessibility Assay:

  • Treat proteoliposomes containing arnE/arnF with membrane-impermeable N-hydroxysulfosuccinimidobiotin

  • Extract and analyze lipids by thin-layer chromatography

  • Detect biotinylated undecaprenyl phosphate-α-L-Ara4N using streptavidin probes

  • Quantify the accessible pool on the outer leaflet

Mass Spectrometry Approaches:

  • Prepare asymmetrically labeled proteoliposomes

  • Allow flippase activity to proceed

  • Extract inner and outer leaflets using cyclodextrin or phospholipase digestion

  • Analyze lipid distribution by LC-MS/MS

3. Functional Reconstitution Assays:

Coupled Enzymatic Assay:

  • Reconstitute arnE/arnF with ArnT in proteoliposomes

  • Supply undecaprenyl phosphate-α-L-Ara4N and fluorescently labeled lipid A analogs

  • Monitor ArnT-mediated transfer as a readout of successful flipping

  • Quantify modified lipid A by HPLC or mass spectrometry

4. Biophysical Approaches:

Stopped-Flow Spectroscopy:

  • Rapidly mix protein-containing liposomes with substrate

  • Monitor fluorescence changes in real-time

  • Determine kinetic parameters of the flipping reaction

These assays provide complementary approaches to measure arnE flippase activity, allowing for comprehensive characterization of its biochemical properties, substrate specificity, and kinetic parameters.

How can gene knockout studies be designed to evaluate arnE function?

Designing effective gene knockout studies to evaluate arnE function requires careful planning and precise genetic manipulation techniques. The following methodological approach ensures robust results:

1. Selection of Bacterial Strains:

  • Choose a polymyxin-resistant strain with constitutively active PmrA system

  • Include wild-type and known polymyxin-sensitive strains as controls

  • Consider multiple Aeromonas species or strains for comparative analysis

2. Knockout Strategy Design:

Method Selection:

  • CRISPR-Cas9 system: Precise gene editing with minimal off-target effects

  • Allelic exchange with suicide vectors: Traditional approach for Aeromonas

  • Transposon mutagenesis: For initial screening of multiple genes

  • Lambda Red recombinase: Efficient for E. coli but requires adaptation for Aeromonas

Target Design:

  • Complete gene deletion vs. internal disruption

  • Consideration of polar effects on downstream genes

  • Preservation of regulatory elements for complementation studies

3. Genetic Manipulation Protocol:

For Allelic Exchange Method:

  • Design homologous regions flanking arnE (800-1000 bp each)

  • Clone flanking regions into suicide vector (e.g., pDMS197)

  • Introduce antibiotic resistance marker between flanking regions

  • Transform into E. coli S17-1 for conjugation

  • Perform conjugation with Aeromonas recipient

  • Select for first recombination event (vector integration)

  • Counter-select for second recombination (vector excision)

  • Screen for successful gene replacement

4. Verification of Knockout:

  • PCR verification with primers flanking the target region

  • Whole-genome sequencing to confirm clean deletion

  • RT-PCR to verify absence of transcript

  • Western blotting to confirm absence of protein

5. Phenotypic Analysis:

Resistance Profiling:

  • Minimum inhibitory concentration (MIC) determination for polymyxins

  • Time-kill assays with various antimicrobial peptides

  • Disk diffusion assays for phenotypic screening

Lipid A Analysis:

  • Mass spectrometry of extracted lipid A to detect L-Ara4N modification

  • Thin-layer chromatography for rapid screening

  • NMR analysis for detailed structural characterization

6. Complementation Studies:

  • Reintroduce wild-type arnE on plasmid or chromosomally

  • Include expression controls (constitutive or inducible promoters)

  • Test complementation with homologs from other species

  • Introduce point mutations to identify essential residues

This comprehensive approach to gene knockout studies provides definitive evidence for arnE function in lipid A modification and antimicrobial peptide resistance, while allowing for detailed mechanistic investigations.

What bioinformatic approaches are useful for analyzing arnE sequence conservation across Aeromonas species?

Bioinformatic analysis of arnE sequence conservation across Aeromonas species provides valuable insights into evolutionary relationships, functional constraints, and species-specific adaptations. The following methodological approaches are particularly useful:

1. Sequence Acquisition and Database Mining:

  • Retrieve arnE sequences from GenBank, UniProt, and specialized databases

  • Perform BLAST searches against genomic sequences of various Aeromonas species

  • Include diverse strains from different ecological niches and host associations

  • Extract genomic context information to identify synteny and operonic structure

2. Multiple Sequence Alignment (MSA) Analysis:

Alignment Methods:

  • MUSCLE or MAFFT for initial alignment of full-length sequences

  • T-Coffee or PRALINE for transmembrane protein-specific alignment

  • Manual curation focusing on transmembrane domains and functional motifs

Conservation Analysis:

  • Calculate position-specific conservation scores

  • Identify highly conserved regions as potential functional domains

  • Map conservation onto predicted secondary structure

  • Compare conservation patterns between different Aeromonas lineages

3. Phylogenetic Analysis:

Tree Construction:

  • Maximum Likelihood methods (RAxML, IQ-TREE)

  • Bayesian inference (MrBayes)

  • Distance-based methods (Neighbor-Joining) for preliminary analysis

Evolutionary Model Selection:

  • Perform model testing to determine optimal substitution model

  • Consider site-specific rate variation

  • Account for among-site rate heterogeneity

4. Structural Prediction and Analysis:

Transmembrane Topology Prediction:

  • TMHMM, TOPCONS, or MEMSAT for transmembrane helix prediction

  • Compare predicted topologies across species for structural conservation

3D Structure Prediction:

  • AlphaFold2 or RoseTTAFold for ab initio structure prediction

  • Homology modeling based on related proteins with known structures

  • Analyze conservation in context of predicted 3D structure

5. Functional Motif Identification:

Domain Analysis:

  • Search for conserved domains using InterProScan or PFAM

  • Identify novel motifs using MEME or GLAM2

  • Compare with other flippase proteins for shared functional elements

6. Selective Pressure Analysis:

dN/dS Calculation:

  • PAML or HyPhy to calculate nonsynonymous to synonymous substitution ratios

  • Site-specific selection analysis to identify positions under positive selection

  • Branch-site models to detect lineage-specific selective pressures

7. Comparative Genomic Context:

Operon Structure Analysis:

  • Examine gene neighborhood conservation across species

  • Identify co-evolved genes that may functionally interact with arnE

  • Compare with other bacterial genera for broader evolutionary context

These bioinformatic approaches collectively provide a comprehensive understanding of arnE evolution and conservation, informing experimental studies and highlighting species-specific adaptations in the context of pathogenicity and antibiotic resistance.

How can structural studies of membrane-embedded arnE protein be conducted?

Structural studies of membrane-embedded proteins like arnE present unique challenges due to their hydrophobic nature and the complexity of their native lipid environment. The following methodological approaches address these challenges:

1. X-ray Crystallography Approaches:

Protein Preparation:

  • Express with fusion partners to increase solubility

  • Engineer thermostabilizing mutations to enhance stability

  • Remove flexible regions that hinder crystallization

  • Use antibody fragments or nanobodies to stabilize specific conformations

Crystallization Methods:

  • Lipidic cubic phase (LCP) crystallization

  • Bicelle-based crystallization

  • Detergent-based vapor diffusion with specific additives

  • In meso crystallization techniques

2. Cryo-Electron Microscopy (Cryo-EM):

Sample Preparation:

  • Reconstitute arnE/arnF complex in nanodiscs with defined lipid composition

  • Use amphipols or SMALPs to maintain native-like environment

  • Consider GraFix method for stabilization of protein complexes

Data Collection and Processing:

  • High-end electron microscopes with direct electron detectors

  • Motion correction and CTF estimation

  • 2D classification and 3D reconstruction

  • Focused refinement of flexible regions

3. NMR Spectroscopy:

Sample Considerations:

  • Isotopic labeling (15N, 13C, 2H) for multidimensional experiments

  • Selective methyl labeling for larger proteins

  • Reconstitution in detergent micelles or nanodiscs

Experimental Approaches:

  • Solution NMR for smaller constructs or domains

  • Solid-state NMR for full-length protein in lipid bilayers

  • Paramagnetic relaxation enhancement (PRE) for distance constraints

  • Residual dipolar couplings (RDCs) for orientation information

4. Molecular Dynamics Simulations:

Model Building:

  • Homology modeling based on related flippase structures

  • Ab initio modeling of transmembrane domains

  • Integration of experimental constraints

Simulation Parameters:

  • All-atom simulations in explicit membrane bilayers

  • Coarse-grained approaches for longer timescales

  • Enhanced sampling techniques (metadynamics, replica exchange)

  • Simulation of substrate binding and translocation

5. Cross-Linking Mass Spectrometry:

Cross-Linking Strategy:

  • Use membrane-permeable cross-linkers with various spacer lengths

  • Apply photo-activated cross-linkers for precise temporal control

  • Implement cross-linking with enrichable functional groups

Analysis Pipeline:

  • Liquid chromatography-tandem mass spectrometry (LC-MS/MS)

  • Cross-link identification with specialized software (pLink, Kojak)

  • Integration with computational modeling

6. Hydrogen-Deuterium Exchange Mass Spectrometry:

Experimental Design:

  • Controlled D2O exposure of reconstituted arnE

  • Quenching and pepsin digestion

  • LC-MS analysis of deuterium incorporation

Data Interpretation:

  • Identify protected and exposed regions

  • Map dynamics to structural models

  • Assess conformational changes upon substrate binding

These complementary structural biology approaches, when combined, provide comprehensive insights into the three-dimensional architecture, dynamics, and mechanism of the arnE flippase component, contributing to our understanding of membrane protein biology and bacterial resistance mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.