Recombinant Aeromonas hydrophila subsp. hydrophila Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Shipped with Ice Packs
In Stock

Description

Product Overview

The recombinant Aeromonas hydrophila subsp. hydrophila Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF) is a bioengineered protein expressed in Escherichia coli. It represents the full-length (1–147 amino acids) version of the ArnF subunit, fused with an N-terminal His tag for purification. This protein is critical for translocating 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) across the inner membrane, a process essential for bacterial membrane integrity and antimicrobial resistance .

CharacteristicDetail
Catalog NumberRFL21611AF
SpeciesAeromonas hydrophila subsp. hydrophila
Expression SystemE. coli
TagN-terminal His tag
Protein LengthFull-length (1–147 amino acids)
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); 5–50% glycerol recommended

Functional Role

ArnF is part of the undecaprenyl phosphate-aminoarabinose flippase complex, which transports α-L-Ara4N-phosphoundecaprenol from the cytoplasm to the periplasm. This lipid modification is linked to:

  • Lipopolysaccharide (LPS) biosynthesis: Incorporation of α-L-Ara4N into LPS enhances bacterial resistance to antimicrobial peptides .

  • Membrane stability: Proper lipid flipping maintains membrane asymmetry, critical for cell viability .

Expression and Purification

  • Host: E. coli (optimized for high-yield expression).

  • Purification: Affinity chromatography (His tag) followed by SDS-PAGE validation .

  • Storage: Aliquots stored at -20°C/-80°C to prevent degradation .

ParameterSpecification
HandlingAvoid repeated freeze-thaw cycles
StabilityWorking aliquots stable at 4°C for 1 week
BufferTris/PBS with trehalose to prevent aggregation

Antimicrobial Resistance Research

ArnF’s role in LPS modification makes it a target for disrupting bacterial defense mechanisms. For example:

  • Inhibitor Screening: Recombinant ArnF could be used to test small molecules targeting α-L-Ara4N incorporation .

Vaccine Development

While not directly tested for A. hydrophila, recombinant flippase subunits in other pathogens (e.g., Pseudomonas) are explored as vaccine candidates .

Related Proteins and Context

ArnF is distinct from ArnE, another subunit in the flippase complex. While ArnF facilitates substrate translocation, ArnE may assist in substrate recognition or stabilization .

ProteinFunctionSource
ArnFTranslocates α-L-Ara4N-phosphoundecaprenolA. hydrophila
ArnEPotential substrate-binding or regulatory rolePseudomonas

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice packaging, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
arnF; AHA_0986; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240)
Target Names
arnF
Target Protein Sequence
MSNDHPQGQLPASPARSALKGYLYVLGSILLVTAAQLGMKWGVIQLPTWQMDLAVMLAHP LPLLVILAGVGCYALSLLCWLAALHSTPLNIAYPLLSTSYALVYLLAVNIPLFAEPLEPG KALGVLFILLGAVLVGIKPAAGTKQTG
Uniprot No.

Target Background

Function
Translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane.
Database Links
Protein Families
ArnF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of ArnF in Aeromonas hydrophila?

ArnF is a probable flippase subunit involved in lipid A modification with 4-amino-4-deoxy-L-arabinose (Ara4N). It functions as part of the arnBCADTEF operon, which encodes proteins required for the biosynthesis and transfer of Ara4N to lipid A. This modification is crucial for bacterial resistance to cationic antimicrobial peptides and polymyxin antibiotics in Gram-negative bacteria . In the Ara4N biosynthesis pathway, ArnF is believed to participate in the translocation of undecaprenyl-phospho-4-deoxy-4-amino-L-arabinose (C55P-Ara4N) across the inner membrane, working in concert with other Arn proteins to facilitate lipid A modification.

How is the arnF gene structured within the arn operon?

The arnF gene is located within the arnBCADTEF operon, which is associated with the pmrE locus. These genes collectively encode the enzymatic machinery necessary for Ara4N biosynthesis and transfer to lipid A. The operon's expression is typically regulated by two-component regulatory systems that respond to environmental stimuli such as low Mg²⁺ conditions or the presence of antimicrobial peptides . Within this gene cluster, arnF is positioned downstream of arnE and works in coordination with other gene products to facilitate the complete modification process.

What experimental methods are commonly used to study arnF expression?

To study arnF expression, researchers typically employ:

  • Quantitative PCR (qPCR): For measuring arnF transcript levels under different growth conditions

  • Reporter gene fusions: Using luciferase or fluorescent protein fusions to monitor promoter activity

  • RNA-Seq: For transcriptome-wide analysis of gene expression changes

  • Selective Capture of Transcribed Sequences (SCOTS): This technique has been successfully used to identify upregulated genes in A. hydrophila during environmental stress conditions

When designing experiments, it's important to consider growth conditions that mimic environments where antimicrobial resistance is relevant, such as low Mg²⁺ media or subinhibitory concentrations of polymyxins.

What methods are optimal for producing recombinant ArnF protein for biochemical studies?

Optimized production of recombinant ArnF requires careful consideration of its membrane-associated nature. Based on studies of related proteins like ArnD , the following methodological approach is recommended:

  • Expression system selection:

    • E. coli BL21(DE3) with pET-based vectors for controlled expression

    • C41(DE3) or C43(DE3) strains specifically developed for membrane protein expression

  • Protein production strategy:

    • Include a C-terminal His-tag for purification

    • Consider fusion tags (MBP, SUMO) to enhance solubility

    • Express at lower temperatures (16-20°C) to improve folding

    • Use mild induction conditions with 0.1-0.5 mM IPTG

  • Membrane protein extraction:

    • Utilize gentle detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG)

    • Consider nanodiscs or amphipols for stabilization in solution

  • Functional verification:

    • Develop in vitro assays to measure flippase activity using fluorescently labeled lipid substrates

The membrane-associated nature of ArnF presents significant challenges, and researchers should verify proper folding through circular dichroism or limited proteolysis experiments.

How does ArnF interact with other proteins in the Ara4N modification pathway?

ArnF is predicted to function as part of a multiprotein complex involved in lipid A modification. Based on studies of the arn operon, potential protein-protein interactions include:

  • ArnE-ArnF complex formation: These proteins likely form a heterodimeric flippase complex similar to other undecaprenyl-phosphate-linked sugar flippases

  • Interactions with ArnC and ArnD: ArnF likely coordinates with ArnC (which transfers Ara4N to undecaprenyl-phosphate) and ArnD (which deformylates the intermediate)

  • Coordination with ArnT: After flipping the C55P-Ara4N to the periplasmic face, ArnF likely transfers the substrate to ArnT for final addition to lipid A

To experimentally investigate these interactions:

  • Bacterial two-hybrid assays to detect protein-protein interactions

  • Co-immunoprecipitation with epitope-tagged proteins

  • Crosslinking studies followed by mass spectrometry

  • Surface plasmon resonance to measure binding affinities

Understanding these interactions is crucial for developing a comprehensive model of the lipid A modification process.

How does environmental stress modulate ArnF expression and function in Aeromonas hydrophila?

A. hydrophila encounters various environmental stressors that may influence arnF expression and function. When investigating this relationship, researchers should consider:

  • Stress conditions relevant to natural environments:

    • Protozoan predation (e.g., Tetrahymena thermophila)

    • Low magnesium conditions

    • Acidic pH

    • Presence of antimicrobial peptides

    • Host immune factors

  • Methodological approach:

    • Expose A. hydrophila to defined stress conditions

    • Monitor arnF expression using qRT-PCR

    • Employ SCOTS (Selective Capture of Transcribed Sequences) to identify stress-specific transcriptional changes

    • Perform ChIP-seq to identify regulators binding to the arnF promoter region

    • Analyze lipid A modifications under different stress conditions

  • Data analysis framework:

    • Compare expression patterns across multiple stressors

    • Develop a regulatory network model incorporating two-component systems

    • Correlate arnF expression with phenotypic antimicrobial resistance

Prior research on A. hydrophila has shown that virulent strains can evade digestion in protozoan vacuoles, with numerous genes upregulated during co-culture with predators . Similar mechanisms may regulate arnF expression when the bacterium encounters stressors in aquatic environments or during host infection.

What structural features of ArnF are essential for its flippase activity and how can they be experimentally validated?

Understanding the structure-function relationship of ArnF requires sophisticated biophysical and molecular approaches:

  • Predicted structural features:

    • Transmembrane domains: ArnF likely contains multiple transmembrane helices forming a channel-like structure

    • Substrate binding pocket: Specific residues for interaction with the Ara4N-phosphoundecaprenol substrate

    • Interface regions: Domains mediating interaction with ArnE and other pathway components

  • Experimental validation methodology:

    • Site-directed mutagenesis targeting conserved residues

    • Cysteine-scanning mutagenesis coupled with accessibility studies

    • Genetic complementation with modified variants

    • Crosslinking studies to capture substrate-protein interactions

    • Cryo-electron microscopy of the reconstituted ArnE-ArnF complex

  • Functional assays:

    • Develop fluorescence-based flippase assays using synthetic lipid vesicles

    • Compare substrate specificity using modified Ara4N analogs

    • In vivo complementation in polymyxin-sensitive strains

This approach parallels successful structural studies of ArnD, which revealed a NodB homology domain characteristic of metal-dependent carbohydrate esterase family 4 (CE4) with unique features including a 44 amino acid insertion and a C-terminal extension .

How does the function of ArnF in Aeromonas hydrophila compare with homologous proteins in other bacterial species?

Comparative analysis of ArnF across bacterial species provides insights into evolutionary conservation and specialized adaptations:

SpeciesArnF Homolog Identity (%)Key Structural DifferencesFunctional Implications
Escherichia coli65-70%Extended N-terminal domainPotentially different regulatory mechanisms
Salmonella enterica68-72%Higher conservation in transmembrane regionsSimilar substrate specificity
Pseudomonas aeruginosa45-50%Variation in periplasmic loopsPossibly altered interaction with other Arn proteins
Vibrio cholerae55-60%Additional cytoplasmic domainPotential for additional protein interactions
Klebsiella pneumoniae63-67%Highly conserved substrate binding regionConserved substrate recognition

To investigate functional conservation experimentally:

  • Generate cross-species complementation constructs

  • Express ArnF homologs in an A. hydrophila arnF knockout strain

  • Assess restoration of polymyxin resistance and lipid A modification

  • Perform detailed comparative genomic analyses of regulatory regions

This approach would reveal species-specific adaptations in ArnF function and regulation, potentially identifying universal mechanisms of antimicrobial resistance that could be targeted therapeutically.

What experimental approaches can be used to develop inhibitors targeting ArnF function?

Developing inhibitors of ArnF function represents a potential strategy for sensitizing A. hydrophila to polymyxins and host antimicrobial peptides. A systematic approach would include:

  • High-throughput screening platforms:

    • Bacterial reporter systems (e.g., using polymyxin-sensitive strains with fluorescent reporters)

    • In vitro flippase activity assays with purified protein

    • Fragment-based screening using thermal shift assays

  • Structure-based design:

    • Homology modeling based on related flippases

    • Virtual screening against the predicted substrate binding site

    • Molecular dynamics simulations to identify allosteric sites

  • Validation methodology:

    • MIC determinations in combination with polymyxins

    • Analysis of lipid A modifications by mass spectrometry

    • Cytotoxicity assessment against mammalian cells

    • Pharmacokinetic and pharmacodynamic studies in animal models

This approach builds upon knowledge of the ArnF structure and function to develop compounds that could potentiate the activity of existing antimicrobials against resistant A. hydrophila strains.

How can recombinant ArnF be incorporated into vaccine development against Aeromonas hydrophila infections?

Recombinant ArnF could serve as a potential vaccine component against A. hydrophila infections, particularly in aquaculture settings where this pathogen causes significant losses. A methodological approach to vaccine development would include:

  • Antigen preparation strategies:

    • Recombinant expression of soluble ArnF domains

    • Whole-cell preparations with upregulated ArnF expression

    • Peptide vaccines targeting immunogenic epitopes

    • DNA vaccines encoding ArnF fragments

  • Delivery systems:

    • Functionalized single-walled carbon nanotubes (SWCNTs) as delivery vehicles, which have shown promise with other A. hydrophila antigens

    • Liposomal formulations to enhance immunogenicity

    • Oral delivery systems for fish immunization

    • Bath immersion protocols for mass vaccination

  • Efficacy assessment:

    • Antibody titer determination

    • Challenge studies with virulent A. hydrophila strains

    • Analysis of immune gene expression in fish tissues

    • Evaluation of intestinal microbiota changes following vaccination

Previous research has demonstrated that recombinant A. hydrophila vaccines delivered via novel carriers can effectively protect fish against infection and influence immune responses in multiple tissues . Incorporating ArnF components might enhance protection by targeting antimicrobial resistance mechanisms.

What methodologies are most effective for studying ArnF regulation in response to host immune factors?

Understanding how host immune factors influence arnF expression provides insights into pathogen adaptation during infection:

  • Ex vivo experimental systems:

    • Co-culture with fish macrophages or neutrophils

    • Exposure to fish antimicrobial peptides at subinhibitory concentrations

    • Culture in serum or tissue homogenates from susceptible hosts

  • Gene expression analysis:

    • Time-course transcriptomics following immune factor exposure

    • SCOTS analysis to identify differentially expressed genes

    • Chromatin immunoprecipitation to identify regulators

    • Single-cell RNA-seq to detect population heterogeneity in expression

  • Genetic manipulation approaches:

    • Construction of promoter-reporter fusions

    • CRISPR interference to modulate expression of regulatory elements

    • Overexpression of transcription factors to identify regulatory pathways

  • Integration with host response data:

    • Parallel RNA-seq of both pathogen and host during interaction

    • Correlation of arnF expression with host immune gene expression

    • Metabolomic analysis to identify host factors influencing regulation

This integrated approach would reveal mechanisms by which A. hydrophila senses and responds to host immunity, potentially identifying targetable pathways for therapeutic intervention.

How can the membrane localization of ArnF be confirmed and its topology mapped?

Confirming membrane localization and determining the topology of ArnF present technical challenges requiring specialized approaches:

  • Localization confirmation methods:

    • Membrane fractionation followed by Western blotting

    • Fluorescent protein fusions with confocal microscopy

    • Immunogold electron microscopy with specific antibodies

    • Protease accessibility assays in spheroplasts

  • Topology mapping techniques:

    • Cysteine accessibility method: Introduce cysteine residues and test their accessibility to membrane-impermeable sulfhydryl reagents

    • Reporter fusion analysis: Fuse topology reporters (PhoA, LacZ) at various positions

    • SCAM (substituted cysteine accessibility method): Systematically replace residues with cysteine and test modification

    • Protease protection assays with epitope-tagged constructs

  • Data interpretation framework:

    • Compare experimental results with topology prediction algorithms

    • Generate a consensus model integrating multiple experimental approaches

    • Validate critical features through targeted mutagenesis

This comprehensive approach would build upon methods successfully used for other membrane proteins in the arn operon, such as ArnD, which was confirmed to be membrane-associated through purification studies .

What strategies can overcome challenges in purifying functional recombinant ArnF protein?

Purification of functional membrane proteins like ArnF presents significant challenges:

  • Optimization of extraction conditions:

    • Screen multiple detergents (DDM, LMNG, LDAO, GDN) at various concentrations

    • Test extraction efficiency with different buffer compositions (pH, salt, glycerol)

    • Evaluate solubilization time and temperature parameters

    • Consider styrene-maleic acid lipid particles (SMALPs) for native membrane extraction

  • Purification strategy refinement:

    • Implement two-step affinity chromatography with orthogonal tags

    • Include size exclusion chromatography to remove aggregates

    • Consider on-column detergent exchange during purification

    • Use lipid additives to stabilize the protein during purification

  • Functional verification methods:

    • Develop native gel electrophoresis protocols to assess oligomeric state

    • Implement thermal stability assays with various buffer conditions

    • Perform lipid binding assays with fluorescently labeled substrates

    • Reconstitute protein into proteoliposomes for functional testing

These approaches draw on successful strategies used for other challenging membrane proteins and would need to be specifically optimized for ArnF's biochemical properties.

How can researchers distinguish between direct effects of arnF mutation and polar effects on downstream genes?

When studying arnF through genetic manipulation, distinguishing direct effects from polar effects requires careful experimental design:

  • Non-polar mutation generation:

    • Use precise in-frame deletions without disrupting neighboring genes

    • Employ marker-less deletion methods to avoid transcriptional interference

    • Consider CRISPR-Cas9 genome editing for precise modifications

    • Design mutations that don't disrupt operon-level regulatory elements

  • Complementation strategies:

    • Provide arnF alone on a plasmid with its native promoter

    • Create an operon reconstruction with arnF and downstream genes

    • Use inducible promoters to control expression levels

    • Generate point mutations that disrupt function without affecting expression

  • Validation experiments:

    • Measure transcript levels of all operon genes in mutant strains

    • Perform protein expression analysis of ArnF and related proteins

    • Conduct phenotypic rescue experiments with various complementation constructs

    • Test for restoration of specific biochemical activities (lipid A modification)

This methodological approach ensures that phenotypes attributed to arnF mutation are indeed due to loss of ArnF function rather than disruption of the operon structure.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.